| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ANKRD13A-ATP2A2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ANKRD13A-ATP2A2 | FusionPDB ID: 4587 | FusionGDB2.0 ID: 4587 | Hgene | Tgene | Gene symbol | ANKRD13A | ATP2A2 | Gene ID | 88455 | 488 |
| Gene name | ankyrin repeat domain 13A | ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 | |
| Synonyms | ANKRD13|NY-REN-25 | ATP2B|DAR|DD|SERCA2 | |
| Cytomap | 12q24.11 | 12q24.11 | |
| Type of gene | protein-coding | protein-coding | |
| Description | ankyrin repeat domain-containing protein 13ANY-REN-25 antigen | sarcoplasmic/endoplasmic reticulum calcium ATPase 2ATPase Ca++ transporting cardiac muscle slow twitch 2ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2SR Ca(2+)-ATPase 2calcium pump 2calcium-transporting ATPase sarcoplasmic reticulum type, slow | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q8IZ07 | P16615 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000550404, ENST00000261739, | ENST00000308664, ENST00000395494, ENST00000539276, ENST00000550248, ENST00000552636, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 2 X 3=18 | 19 X 23 X 6=2622 |
| # samples | 3 | 23 | |
| ** MAII score | log2(3/18*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(23/2622*10)=-3.51096191927738 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ANKRD13A [Title/Abstract] AND ATP2A2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ANKRD13A(110437589)-ATP2A2(110734404), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ANKRD13A-ATP2A2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ANKRD13A-ATP2A2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ANKRD13A-ATP2A2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ANKRD13A-ATP2A2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ANKRD13A | GO:1905667 | negative regulation of protein localization to endosome | 22298428 |
| Tgene | ATP2A2 | GO:0032469 | endoplasmic reticulum calcium ion homeostasis | 16402920 |
| Tgene | ATP2A2 | GO:0032470 | positive regulation of endoplasmic reticulum calcium ion concentration | 16402920 |
| Tgene | ATP2A2 | GO:0070588 | calcium ion transmembrane transport | 16402920 |
| Tgene | ATP2A2 | GO:1903515 | calcium ion transport from cytosol to endoplasmic reticulum | 16402920 |
| Fusion gene breakpoints across ANKRD13A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across ATP2A2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-D7-8574-01A | ANKRD13A | chr12 | 110437589 | + | ATP2A2 | chr12 | 110734404 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000261739 | ANKRD13A | chr12 | 110437589 | + | ENST00000308664 | ATP2A2 | chr12 | 110734404 | + | 3717 | 262 | 166 | 2931 | 921 |
| ENST00000261739 | ANKRD13A | chr12 | 110437589 | + | ENST00000395494 | ATP2A2 | chr12 | 110734404 | + | 7604 | 262 | 166 | 2985 | 939 |
| ENST00000261739 | ANKRD13A | chr12 | 110437589 | + | ENST00000539276 | ATP2A2 | chr12 | 110734404 | + | 3923 | 262 | 166 | 3066 | 966 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000261739 | ENST00000308664 | ANKRD13A | chr12 | 110437589 | + | ATP2A2 | chr12 | 110734404 | + | 0.000451152 | 0.99954885 |
| ENST00000261739 | ENST00000395494 | ANKRD13A | chr12 | 110437589 | + | ATP2A2 | chr12 | 110734404 | + | 0.000220331 | 0.99977964 |
| ENST00000261739 | ENST00000539276 | ANKRD13A | chr12 | 110437589 | + | ATP2A2 | chr12 | 110734404 | + | 0.000299179 | 0.9997009 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >4587_4587_1_ANKRD13A-ATP2A2_ANKRD13A_chr12_110437589_ENST00000261739_ATP2A2_chr12_110734404_ENST00000308664_length(amino acids)=921AA_BP=0 MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLT SIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEF GEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTS VICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEK VGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTH IRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQA GIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVND APALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNL VTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVD CAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPV -------------------------------------------------------------- >4587_4587_2_ANKRD13A-ATP2A2_ANKRD13A_chr12_110437589_ENST00000261739_ATP2A2_chr12_110734404_ENST00000395494_length(amino acids)=939AA_BP=0 MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAGESVSVIKHTDP VPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPV HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVE GDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLS KIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGS GSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQ DEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMV LADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNP KEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALN SLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATK -------------------------------------------------------------- >4587_4587_3_ANKRD13A-ATP2A2_ANKRD13A_chr12_110437589_ENST00000261739_ATP2A2_chr12_110734404_ENST00000539276_length(amino acids)=966AA_BP=0 MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLT SIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEF GEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTS VICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEK VGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTH IRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQA GIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVND APALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNL VTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVD CAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPV -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:110437589/chr12:110734404) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ANKRD13A | ATP2A2 |
| FUNCTION: Ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. Does not bind 'Lys-48'-linked ubiquitin. Positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane. {ECO:0000269|PubMed:22298428}. | FUNCTION: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen (PubMed:16402920). Involved in autophagy in response to starvation. Upon interaction with VMP1 and activation, controls ER-isolation membrane contacts for autophagosome formation (PubMed:28890335). Also modulates ER contacts with lipid droplets, mitochondria and endosomes (PubMed:28890335). {ECO:0000269|PubMed:16402920, ECO:0000269|PubMed:28890335}.; FUNCTION: [Isoform 2]: Involved in the regulation of the contraction/relaxation cycle. Acts as a regulator of TNFSF11-mediated Ca(2+) signaling pathways via its interaction with TMEM64 which is critical for the TNFSF11-induced CREB1 activation and mitochondrial ROS generation necessary for proper osteoclast generation. Association between TMEM64 and SERCA2 in the ER leads to cytosolic Ca(2+) spiking for activation of NFATC1 and production of mitochondrial ROS, thereby triggering Ca(2+) signaling cascades that promote osteoclast differentiation and activation. {ECO:0000250|UniProtKB:O55143}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 111_253 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 274_295 | 108.0 | 998.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 314_756 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 777_786 | 108.0 | 998.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 808_827 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 851_896 | 108.0 | 998.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 917_929 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 949_963 | 108.0 | 998.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 985_1042 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 111_253 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 274_295 | 108.0 | 1016.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 314_756 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 777_786 | 108.0 | 1016.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 808_827 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 851_896 | 108.0 | 1016.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 917_929 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 949_963 | 108.0 | 1016.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 985_1042 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 111_253 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 274_295 | 108.0 | 1043.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 314_756 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 777_786 | 108.0 | 1043.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 808_827 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 851_896 | 108.0 | 1043.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 917_929 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 949_963 | 108.0 | 1043.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 985_1042 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 254_273 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D3 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 296_313 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D4 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 757_776 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D5 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 828_850 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D7 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 897_916 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D8 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 930_948 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D9 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 964_984 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D10 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 254_273 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D3 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 296_313 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D4 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 757_776 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D5 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 828_850 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D7 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 897_916 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D8 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 930_948 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D9 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 964_984 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D10 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 254_273 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D3 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 296_313 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D4 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 757_776 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D5 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 828_850 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D7 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 897_916 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D8 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 930_948 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D9 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 964_984 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D10 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 483_502 | 32.0 | 591.0 | Domain | UIM 1 |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 519_538 | 32.0 | 591.0 | Domain | UIM 2 |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 549_568 | 32.0 | 591.0 | Domain | UIM 3 |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 574_590 | 32.0 | 591.0 | Domain | UIM 4 |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 40_69 | 32.0 | 591.0 | Repeat | Note=ANK 1 |
| Hgene | ANKRD13A | chr12:110437589 | chr12:110734404 | ENST00000261739 | + | 1 | 15 | 73_102 | 32.0 | 591.0 | Repeat | Note=ANK 2 |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 1_48 | 108.0 | 998.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 70_89 | 108.0 | 998.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 1_48 | 108.0 | 1016.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 70_89 | 108.0 | 1016.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 1_48 | 108.0 | 1043.0 | Topological domain | Cytoplasmic | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 70_89 | 108.0 | 1043.0 | Topological domain | Lumenal | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 49_69 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D1 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000308664 | 3 | 21 | 90_110 | 108.0 | 998.0 | Transmembrane | Helical%3B Name%3D2 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 49_69 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D1 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000395494 | 3 | 19 | 90_110 | 108.0 | 1016.0 | Transmembrane | Helical%3B Name%3D2 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 49_69 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D1 | |
| Tgene | ATP2A2 | chr12:110437589 | chr12:110734404 | ENST00000539276 | 3 | 20 | 90_110 | 108.0 | 1043.0 | Transmembrane | Helical%3B Name%3D2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ANKRD13A | |
| ATP2A2 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ANKRD13A-ATP2A2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ANKRD13A-ATP2A2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies