UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:LONP1-SAFB2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: LONP1-SAFB2 | FusionPDB ID: 49426 | FusionGDB2.0 ID: 49426 | Hgene | Tgene | Gene symbol | LONP1 | SAFB2 | Gene ID | 9361 | 9667 |
Gene name | lon peptidase 1, mitochondrial | scaffold attachment factor B2 | |
Synonyms | CODASS|LON|LONP|LonHS|PIM1|PRSS15|hLON | - | |
Cytomap | 19p13.3 | 19p13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | lon protease homolog, mitochondrialhLON ATP-dependent proteaselon protease-like proteinmitochondrial ATP-dependent protease Lonmitochondrial lon protease-like proteinserine protease 15 | scaffold attachment factor B2 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P36776 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000360614, ENST00000540670, ENST00000585374, ENST00000590729, ENST00000593119, ENST00000590511, | ENST00000591310, ENST00000252542, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 18 X 14 X 12=3024 | 8 X 8 X 5=320 |
# samples | 23 | 9 | |
** MAII score | log2(23/3024*10)=-3.7167523732767 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/320*10)=-1.83007499855769 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: LONP1 [Title/Abstract] AND SAFB2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | SAFB2(5598804)-LONP1(5708414), # samples:3 LONP1(5705783)-SAFB2(5600271), # samples:1 LONP1(5705782)-SAFB2(5604947), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | LONP1-SAFB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. LONP1-SAFB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. LONP1-SAFB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. LONP1-SAFB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. SAFB2-LONP1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. SAFB2-LONP1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. SAFB2-LONP1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. SAFB2-LONP1 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. SAFB2-LONP1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. SAFB2-LONP1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. LONP1-SAFB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. LONP1-SAFB2 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. LONP1-SAFB2 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. LONP1-SAFB2 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | LONP1 | GO:0034599 | cellular response to oxidative stress | 17420247 |
Hgene | LONP1 | GO:0051603 | proteolysis involved in cellular protein catabolic process | 8248235|17420247 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-AR-A251-01A | LONP1 | chr19 | 5705783 | - | SAFB2 | chr19 | 5600271 | - |
ChimerDB4 | BRCA | TCGA-AR-A251 | LONP1 | chr19 | 5705782 | - | SAFB2 | chr19 | 5604947 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000360614 | LONP1 | chr19 | 5705783 | - | ENST00000252542 | SAFB2 | chr19 | 5600271 | - | 3072 | 1525 | 38 | 2827 | 929 |
ENST00000593119 | LONP1 | chr19 | 5705783 | - | ENST00000252542 | SAFB2 | chr19 | 5600271 | - | 2755 | 1208 | 33 | 2510 | 825 |
ENST00000540670 | LONP1 | chr19 | 5705783 | - | ENST00000252542 | SAFB2 | chr19 | 5600271 | - | 2839 | 1292 | 369 | 2594 | 741 |
ENST00000590729 | LONP1 | chr19 | 5705783 | - | ENST00000252542 | SAFB2 | chr19 | 5600271 | - | 2583 | 1036 | 59 | 2338 | 759 |
ENST00000585374 | LONP1 | chr19 | 5705782 | - | ENST00000252542 | SAFB2 | chr19 | 5604947 | - | 2982 | 1172 | 1238 | 2737 | 499 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000360614 | ENST00000252542 | LONP1 | chr19 | 5705783 | - | SAFB2 | chr19 | 5600271 | - | 0.005275876 | 0.9947241 |
ENST00000593119 | ENST00000252542 | LONP1 | chr19 | 5705783 | - | SAFB2 | chr19 | 5600271 | - | 0.009283451 | 0.9907165 |
ENST00000540670 | ENST00000252542 | LONP1 | chr19 | 5705783 | - | SAFB2 | chr19 | 5600271 | - | 0.016348477 | 0.9836516 |
ENST00000590729 | ENST00000252542 | LONP1 | chr19 | 5705783 | - | SAFB2 | chr19 | 5600271 | - | 0.00664826 | 0.99335176 |
ENST00000585374 | ENST00000252542 | LONP1 | chr19 | 5705782 | - | SAFB2 | chr19 | 5604947 | - | 0.033374153 | 0.9666258 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >49426_49426_1_LONP1-SAFB2_LONP1_chr19_5705782_ENST00000585374_SAFB2_chr19_5604947_ENST00000252542_length(amino acids)=499AA_BP=163 MSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDIKKEE KDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIR ETERRREREQREREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLRYEQE RRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERH GRDSRDGWGGYGSDKRLSEGRGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRG -------------------------------------------------------------- >49426_49426_2_LONP1-SAFB2_LONP1_chr19_5705783_ENST00000360614_SAFB2_chr19_5600271_ENST00000252542_length(amino acids)=929AA_BP=1 MKRLFRATRPSGTEARAGRHVRFAASGNDASCVSRQYGRAMAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGQRTCDASP PWALWGRGPAIGGQWRGFWEASSRGGGAFSGGEDASEGGAEEGAGGAGGSAGAGEGPVITALTPMTIPDVFPHLPLIAITRNPVFPRFIK IIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAE NKHKPRRKSKRGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQA GQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLE KDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFKTVIKKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSG SRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAF HERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPE GKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEG RGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRGGFAQGGHSQGHVVPGGGLEG -------------------------------------------------------------- >49426_49426_3_LONP1-SAFB2_LONP1_chr19_5705783_ENST00000540670_SAFB2_chr19_5600271_ENST00000252542_length(amino acids)=741AA_BP=1 MVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRK SKRGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNP IYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIE EKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFKTVIKKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSGSRGMERTV VMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKAR LQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMED RYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPR GGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRGGFAQGGHSQGHVVPGGGLEGGGVASQDR -------------------------------------------------------------- >49426_49426_4_LONP1-SAFB2_LONP1_chr19_5705783_ENST00000590729_SAFB2_chr19_5600271_ENST00000252542_length(amino acids)=759AA_BP=0 MTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKL RMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSKRGKKEAEDELSARHPAELAMEPTPELPAEVLMVEALTAEIVKTIRDIIALNPLY RESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQL KIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFKTVIKKEEKIEKKEEKKPEDIKKEEKDQDELKPGP TNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQ REREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLRYEQERRPGRRPYDL DRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGG YGSDKRLSEGRGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRGGFAQGGHSQG -------------------------------------------------------------- >49426_49426_5_LONP1-SAFB2_LONP1_chr19_5705783_ENST00000593119_SAFB2_chr19_5600271_ENST00000252542_length(amino acids)=825AA_BP=0 MAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGPVITALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLR RKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSKRGKK EAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDM GAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRER LKELVVPKHVMDVVDEELSKLGLLDNHSSEFKTVIKKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSK GEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKARLQRERL QLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADF PRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPRGGRDWG EHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRGGFAQGGHSQGHVVPGGGLEGGGVASQDRGSRVPH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:5598804/chr19:5708414) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
LONP1 | . |
FUNCTION: ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial promoters and RNA in a single-stranded, site-specific, and strand-specific manner. May regulate mitochondrial DNA replication and/or gene expression using site-specific, single-stranded DNA binding to target the degradation of regulatory proteins binding to adjacent sites in mitochondrial promoters (PubMed:12198491, PubMed:15870080, PubMed:17420247, PubMed:8248235). Endogenous substrates include mitochondrial steroidogenic acute regulatory (StAR) protein, helicase Twinkle (TWNK) and the large ribosomal subunit protein bL32m. bL32m is protected from degradation by LONP1 when it is bound to a nucleic acid (RNA), but TWNK is not (PubMed:17579211, PubMed:28377575). {ECO:0000255|HAMAP-Rule:MF_03120, ECO:0000269|PubMed:12198491, ECO:0000269|PubMed:15870080, ECO:0000269|PubMed:17420247, ECO:0000269|PubMed:17579211, ECO:0000269|PubMed:28377575, ECO:0000269|PubMed:8248235}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | LONP1 | chr19:5705782 | chr19:5604947 | ENST00000360614 | - | 8 | 18 | 124_368 | 455.6666666666667 | 960.0 | Domain | Lon N-terminal |
Hgene | LONP1 | chr19:5705783 | chr19:5600271 | ENST00000360614 | - | 8 | 18 | 124_368 | 455.6666666666667 | 960.0 | Domain | Lon N-terminal |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 482_545 | 432.0 | 954.0 | Compositional bias | Note=Lys-rich | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 619_724 | 432.0 | 954.0 | Compositional bias | Note=Glu-rich | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 621_788 | 432.0 | 954.0 | Compositional bias | Note=Arg-rich | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 792_926 | 432.0 | 954.0 | Compositional bias | Note=Gly-rich | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 619_724 | 519.6666666666666 | 954.0 | Compositional bias | Note=Glu-rich | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 621_788 | 519.6666666666666 | 954.0 | Compositional bias | Note=Arg-rich | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 792_926 | 519.6666666666666 | 954.0 | Compositional bias | Note=Gly-rich | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 713_730 | 432.0 | 954.0 | Motif | Nuclear localization signal | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 713_730 | 519.6666666666666 | 954.0 | Motif | Nuclear localization signal |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | LONP1 | chr19:5705782 | chr19:5604947 | ENST00000360614 | - | 8 | 18 | 759_949 | 455.6666666666667 | 960.0 | Domain | Lon proteolytic |
Hgene | LONP1 | chr19:5705783 | chr19:5600271 | ENST00000360614 | - | 8 | 18 | 759_949 | 455.6666666666667 | 960.0 | Domain | Lon proteolytic |
Hgene | LONP1 | chr19:5705782 | chr19:5604947 | ENST00000360614 | - | 8 | 18 | 523_530 | 455.6666666666667 | 960.0 | Nucleotide binding | ATP |
Hgene | LONP1 | chr19:5705783 | chr19:5600271 | ENST00000360614 | - | 8 | 18 | 523_530 | 455.6666666666667 | 960.0 | Nucleotide binding | ATP |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 482_545 | 519.6666666666666 | 954.0 | Compositional bias | Note=Lys-rich | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 30_64 | 432.0 | 954.0 | Domain | SAP | |
Tgene | SAFB2 | chr19:5705782 | chr19:5604947 | ENST00000252542 | 8 | 21 | 407_485 | 432.0 | 954.0 | Domain | RRM | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 30_64 | 519.6666666666666 | 954.0 | Domain | SAP | |
Tgene | SAFB2 | chr19:5705783 | chr19:5600271 | ENST00000252542 | 10 | 21 | 407_485 | 519.6666666666666 | 954.0 | Domain | RRM |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
LONP1 | |
SAFB2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to LONP1-SAFB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to LONP1-SAFB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |