| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MAP4K2-FXR2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MAP4K2-FXR2 | FusionPDB ID: 51387 | FusionGDB2.0 ID: 51387 | Hgene | Tgene | Gene symbol | MAP4K2 | FXR2 | Gene ID | 5871 | 9513 |
| Gene name | mitogen-activated protein kinase kinase kinase kinase 2 | FMR1 autosomal homolog 2 | |
| Synonyms | BL44|GCK|RAB8IP | FMR1L2|FXR2P | |
| Cytomap | 11q13.1 | 17p13.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mitogen-activated protein kinase kinase kinase kinase 2B lymphocyte serine/threonine protein kinaseMAPK/ERK kinase kinase kinase 2MEK kinase kinase 2MEKKK 2Rab8 interacting proteingerminal centre kinase (GC kinase) | fragile X mental retardation syndrome-related protein 2fragile X mental retardation, autosomal homolog 2fragile X-mental retardation 1-like 2 | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | Q12851 | P51116 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000294066, ENST00000377350, ENST00000468062, | ENST00000573057, ENST00000250113, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 4 X 3=36 | 10 X 9 X 6=540 |
| # samples | 3 | 11 | |
| ** MAII score | log2(3/36*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/540*10)=-2.29545588352617 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MAP4K2 [Title/Abstract] AND FXR2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAP4K2(64563744)-FXR2(7506320), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | MAP4K2-FXR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAP4K2-FXR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAP4K2-FXR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAP4K2-FXR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAP4K2 | GO:0006468 | protein phosphorylation | 11784851 |
| Hgene | MAP4K2 | GO:0007257 | activation of JUN kinase activity | 17584736 |
| Hgene | MAP4K2 | GO:0035556 | intracellular signal transduction | 11784851 |
| Hgene | MAP4K2 | GO:0046330 | positive regulation of JNK cascade | 17584736 |
| Fusion gene breakpoints across MAP4K2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across FXR2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | OV | TCGA-24-2033 | MAP4K2 | chr11 | 64563744 | - | FXR2 | chr17 | 7506320 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000377350 | MAP4K2 | chr11 | 64563744 | - | ENST00000250113 | FXR2 | chr17 | 7506320 | - | 3992 | 1819 | 92 | 3391 | 1099 |
| ENST00000294066 | MAP4K2 | chr11 | 64563744 | - | ENST00000250113 | FXR2 | chr17 | 7506320 | - | 4016 | 1843 | 92 | 3415 | 1107 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000377350 | ENST00000250113 | MAP4K2 | chr11 | 64563744 | - | FXR2 | chr17 | 7506320 | - | 0.004174853 | 0.9958252 |
| ENST00000294066 | ENST00000250113 | MAP4K2 | chr11 | 64563744 | - | FXR2 | chr17 | 7506320 | - | 0.00312591 | 0.9968741 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >51387_51387_1_MAP4K2-FXR2_MAP4K2_chr11_64563744_ENST00000294066_FXR2_chr17_7506320_ENST00000250113_length(amino acids)=1107AA_BP=583 MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRLWICM EFCGGGSLQEIYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKLLQH PFTTQQLPRALLTQLLDKASDPHLGTPSPEDCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQ REDPERSSCHGLPPTPKVHMGACFSKVFNGCPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPSCSNENVHKEFKKALGANCIFLNITNSELFILSTTEAPVKRASLLGD MHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQAR SYLEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVEQLRL ERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRA GPGDRDPPTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPPASARRRRSRRRRTDED RTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSV -------------------------------------------------------------- >51387_51387_2_MAP4K2-FXR2_MAP4K2_chr11_64563744_ENST00000377350_FXR2_chr17_7506320_ENST00000250113_length(amino acids)=1099AA_BP=575 MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRLWICM EFCGGGSLQEIYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKLLQH PFTTQQLPRALLTQLLDKASDPHLGTPSPEDCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGPNSSPLLPTAWATMKQREDPERSS CHGLPPTPKVHMGACFSKVFNGCPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVLLSLSGKST HIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPSCSNENVHKEFKKALGANCIFLNITNSELFILSTTEAPVKRASLLGDMHFRSLRT KLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSED SVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVEQLRLERLQIDEQ LRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPP TRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPPASARRRRSRRRRTDEDRTVMDGGL ESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLPKGPS -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:64563744/chr17:7506320) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAP4K2 | FXR2 |
| FUNCTION: Serine/threonine-protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Acts as a MAPK kinase kinase kinase (MAP4K) and is an upstream activator of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway and to a lesser extent of the p38 MAPKs signaling pathway. Required for the efficient activation of JNKs by TRAF6-dependent stimuli, including pathogen-associated molecular patterns (PAMPs) such as polyinosine-polycytidine (poly(IC)), lipopolysaccharides (LPS), lipid A, peptidoglycan (PGN), or bacterial flagellin. To a lesser degree, IL-1 and engagement of CD40 also stimulate MAP4K2-mediated JNKs activation. The requirement for MAP4K2/GCK is most pronounced for LPS signaling, and extends to LPS stimulation of c-Jun phosphorylation and induction of IL-8. Enhances MAP3K1 oligomerization, which may relieve N-terminal mediated MAP3K1 autoinhibition and lead to activation following autophosphorylation. Mediates also the SAP/JNK signaling pathway and the p38 MAPKs signaling pathway through activation of the MAP3Ks MAP3K10/MLK2 and MAP3K11/MLK3. May play a role in the regulation of vesicle targeting or fusion. regulation of vesicle targeting or fusion. {ECO:0000269|PubMed:11784851, ECO:0000269|PubMed:15456887, ECO:0000269|PubMed:17584736, ECO:0000269|PubMed:7477268, ECO:0000269|PubMed:7515885, ECO:0000269|PubMed:9712898}. | FUNCTION: RNA-binding protein. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 16_273 | 583.6666666666666 | 821.0 | Domain | Protein kinase |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 22_30 | 583.6666666666666 | 821.0 | Nucleotide binding | ATP |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 294_314 | 583.6666666666666 | 821.0 | Region | Note=PEST1 |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 344_360 | 583.6666666666666 | 821.0 | Region | Note=PEST2 |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 405_448 | 583.6666666666666 | 821.0 | Region | Note=PEST3 |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 414_418 | 149.66666666666666 | 674.0 | Compositional bias | Note=Poly-Ser | |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 544_552 | 149.66666666666666 | 674.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 584_594 | 149.66666666666666 | 674.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 232_261 | 149.66666666666666 | 674.0 | Domain | KH 1 | |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 295_324 | 149.66666666666666 | 674.0 | Domain | KH 2 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAP4K2 | chr11:64563744 | chr17:7506320 | ENST00000294066 | - | 24 | 32 | 482_793 | 583.6666666666666 | 821.0 | Domain | CNH |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 14_60 | 149.66666666666666 | 674.0 | Domain | Agenet-like 1 | |
| Tgene | FXR2 | chr11:64563744 | chr17:7506320 | ENST00000250113 | 4 | 17 | 73_125 | 149.66666666666666 | 674.0 | Domain | Agenet-like 2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MAP4K2 | |
| FXR2 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MAP4K2-FXR2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAP4K2-FXR2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies