| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MYCBP2-CPB2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MYCBP2-CPB2 | FusionPDB ID: 56200 | FusionGDB2.0 ID: 56200 | Hgene | Tgene | Gene symbol | MYCBP2 | CPB2 | Gene ID | 23077 | 1361 |
| Gene name | MYC binding protein 2 | carboxypeptidase B2 | |
| Synonyms | Myc-bp2|PAM|PHR1|Phr | CPU|PCPB|TAFI | |
| Cytomap | 13q22.3 | 13q14.13 | |
| Type of gene | protein-coding | protein-coding | |
| Description | E3 ubiquitin-protein ligase MYCBP2HighwireMYC binding protein 2, E3 ubiquitin protein ligasePAM/Highwire/RPM-1 protein 1RING-type E3 ubiquitin transferase MYCBP2myc-binding protein 2pam/highwire/rpm-1 proteinprotein associated with Myc | carboxypeptidase B2carboxypeptidase B-like proteincarboxypeptidase B2 (plasma)carboxypeptidase B2 (plasma, carboxypeptidase U)carboxypeptidase Rthrombin-activable fibrinolysis inhibitorthrombin-activatable fibrinolysis inhibitor | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | O75592 | Q96IY4 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000360084, ENST00000357337, ENST00000407578, ENST00000544440, ENST00000482517, | ENST00000181383, ENST00000439329, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 14 X 16 X 8=1792 | 2 X 2 X 2=8 |
| # samples | 15 | 2 | |
| ** MAII score | log2(15/1792*10)=-3.57853623156172 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MYCBP2 [Title/Abstract] AND CPB2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MYCBP2(77862296)-CPB2(46638876), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | MYCBP2-CPB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MYCBP2-CPB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MYCBP2-CPB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MYCBP2-CPB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MYCBP2-CPB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MYCBP2-CPB2 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MYCBP2 | GO:0016567 | protein ubiquitination | 29643511 |
| Hgene | MYCBP2 | GO:0031398 | positive regulation of protein ubiquitination | 20534529 |
| Fusion gene breakpoints across MYCBP2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CPB2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BLCA | TCGA-UY-A78N-01A | MYCBP2 | chr13 | 77862296 | - | CPB2 | chr13 | 46638876 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000544440 | MYCBP2 | chr13 | 77862296 | - | ENST00000181383 | CPB2 | chr13 | 46638876 | - | 1496 | 498 | 12 | 1067 | 351 |
| ENST00000544440 | MYCBP2 | chr13 | 77862296 | - | ENST00000439329 | CPB2 | chr13 | 46638876 | - | 1443 | 498 | 12 | 989 | 325 |
| ENST00000407578 | MYCBP2 | chr13 | 77862296 | - | ENST00000181383 | CPB2 | chr13 | 46638876 | - | 1859 | 861 | 183 | 1430 | 415 |
| ENST00000407578 | MYCBP2 | chr13 | 77862296 | - | ENST00000439329 | CPB2 | chr13 | 46638876 | - | 1806 | 861 | 183 | 1352 | 389 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000544440 | ENST00000181383 | MYCBP2 | chr13 | 77862296 | - | CPB2 | chr13 | 46638876 | - | 0.001025955 | 0.9989741 |
| ENST00000544440 | ENST00000439329 | MYCBP2 | chr13 | 77862296 | - | CPB2 | chr13 | 46638876 | - | 0.001211324 | 0.99878865 |
| ENST00000407578 | ENST00000181383 | MYCBP2 | chr13 | 77862296 | - | CPB2 | chr13 | 46638876 | - | 0.001603996 | 0.998396 |
| ENST00000407578 | ENST00000439329 | MYCBP2 | chr13 | 77862296 | - | CPB2 | chr13 | 46638876 | - | 0.001544565 | 0.9984554 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >56200_56200_1_MYCBP2-CPB2_MYCBP2_chr13_77862296_ENST00000407578_CPB2_chr13_46638876_ENST00000181383_length(amino acids)=415AA_BP=226 MEKGCVCARVSARPARGDEAAAAAAAARMMMCAATASPAAASSGLGGDGFYPAATFSSSPAPGALFMPVPDGSVAAAGLGLGLPAADSRG HYQLLLSGRALADRYRRIYTAALNDRDQGGGSAGHPASRNKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYC NVRHCVLEWQKKEISLAAASKNSVQSGESDSDEEEESKEPPIKLPKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETY CGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKNTRYTHGHGSETLYLAPGG -------------------------------------------------------------- >56200_56200_2_MYCBP2-CPB2_MYCBP2_chr13_77862296_ENST00000407578_CPB2_chr13_46638876_ENST00000439329_length(amino acids)=389AA_BP=226 MEKGCVCARVSARPARGDEAAAAAAAARMMMCAATASPAAASSGLGGDGFYPAATFSSSPAPGALFMPVPDGSVAAAGLGLGLPAADSRG HYQLLLSGRALADRYRRIYTAALNDRDQGGGSAGHPASRNKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYC NVRHCVLEWQKKEISLAAASKNSVQSGESDSDEEEESKEPPIKLPKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETY CGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKNTRYTHGHGSETLYLAPGG -------------------------------------------------------------- >56200_56200_3_MYCBP2-CPB2_MYCBP2_chr13_77862296_ENST00000544440_CPB2_chr13_46638876_ENST00000181383_length(amino acids)=351AA_BP=162 MFMPVPDGSVAAAGLGLGLPAADSRGHYQLLLSGRALADRYRRIYTAALNDRDQGGGSAGHPASRNKKILNKKKLKRKQKSKSKVKTRSK SENLENTVIIPDIKLHSNPSAFNIYCNVRHCVLEWQKKEISLAAASKNSVQSGESDSDEEEESKEPPIKLPKNRMWRKNRSFYANNHCIG TDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVR -------------------------------------------------------------- >56200_56200_4_MYCBP2-CPB2_MYCBP2_chr13_77862296_ENST00000544440_CPB2_chr13_46638876_ENST00000439329_length(amino acids)=325AA_BP=162 MFMPVPDGSVAAAGLGLGLPAADSRGHYQLLLSGRALADRYRRIYTAALNDRDQGGGSAGHPASRNKKILNKKKLKRKQKSKSKVKTRSK SENLENTVIIPDIKLHSNPSAFNIYCNVRHCVLEWQKKEISLAAASKNSVQSGESDSDEEEESKEPPIKLPKNRMWRKNRSFYANNHCIG TDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVR -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:77862296/chr13:46638876) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MYCBP2 | CPB2 |
| FUNCTION: Atypical E3 ubiquitin-protein ligase which specifically mediates ubiquitination of threonine and serine residues on target proteins, instead of ubiquitinating lysine residues (PubMed:29643511). Shows esterification activity towards both threonine and serine, with a preference for threonine, and acts via two essential catalytic cysteine residues that relay ubiquitin to its substrate via thioester intermediates (PubMed:29643511). Interacts with the E2 enzymes UBE2D1, UBE2D3, UBE2E1 and UBE2L3 (PubMed:18308511, PubMed:29643511). Plays a key role in neural development, probably by mediating ubiquitination of threonine residues on target proteins (Probable). Involved in different processes such as regulation of neurite outgrowth, synaptic growth, synaptogenesis and axon degeneration (By similarity). Required for the formation of major central nervous system axon tracts (By similarity). Required for proper axon growth by regulating axon navigation and axon branching: acts by regulating the subcellular location and stability of MAP3K12/DLK (By similarity). Required for proper localization of retinogeniculate projections but not for eye-specific segregation (By similarity). Regulates axon guidance in the olfactory system (By similarity). Involved in Wallerian axon degeneration, an evolutionarily conserved process that drives the loss of damaged axons: acts by promoting destabilization of NMNAT2, probably via ubiquitination of NMNAT2 (By similarity). Catalyzes ubiquitination of threonine and/or serine residues on NMNAT2, consequences of threonine and/or serine ubiquitination are however unknown (PubMed:29643511). Regulates the internalization of TRPV1 in peripheral sensory neurons (By similarity). Mediates ubiquitination and subsequent proteasomal degradation of TSC2/tuberin (PubMed:18308511, PubMed:27278822). Independently of the E3 ubiquitin-protein ligase activity, also acts as a guanosine exchange factor (GEF) for RAN in neurons of dorsal root ganglia (PubMed:26304119). May function as a facilitator or regulator of transcriptional activation by MYC (PubMed:9689053). Acts in concert with HUWE1 to regulate the circadian clock gene expression by promoting the lithium-induced ubiquination and degradation of NR1D1 (PubMed:20534529). {ECO:0000250|UniProtKB:Q7TPH6, ECO:0000269|PubMed:18308511, ECO:0000269|PubMed:20534529, ECO:0000269|PubMed:26304119, ECO:0000269|PubMed:27278822, ECO:0000269|PubMed:29643511, ECO:0000269|PubMed:9689053}. | FUNCTION: Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin. {ECO:0000269|PubMed:10574983}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 103_126 | 160.0 | 4641.0 | Compositional bias | Lys-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 103_126 | 160.0 | 4641.0 | Compositional bias | Lys-rich |
| Tgene | CPB2 | chr13:77862296 | chr13:46638876 | ENST00000181383 | 6 | 11 | 256_257 | 234.0 | 424.0 | Region | Substrate binding | |
| Tgene | CPB2 | chr13:77862296 | chr13:46638876 | ENST00000181383 | 6 | 11 | 311_312 | 234.0 | 424.0 | Region | Substrate binding |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 2720_2844 | 160.0 | 4641.0 | Compositional bias | Ser-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 3194_3215 | 160.0 | 4641.0 | Compositional bias | Lys-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 3262_3293 | 160.0 | 4641.0 | Compositional bias | Note=Gly-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 766_814 | 160.0 | 4641.0 | Compositional bias | Cys-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 2720_2844 | 160.0 | 4641.0 | Compositional bias | Ser-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 3194_3215 | 160.0 | 4641.0 | Compositional bias | Lys-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 3262_3293 | 160.0 | 4641.0 | Compositional bias | Note=Gly-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 766_814 | 160.0 | 4641.0 | Compositional bias | Cys-rich |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 3719_3897 | 160.0 | 4641.0 | Domain | DOC |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 3719_3897 | 160.0 | 4641.0 | Domain | DOC |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 1235_1386 | 160.0 | 4641.0 | Region | PHR domain 1 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 1726_1884 | 160.0 | 4641.0 | Region | PHR domain 2 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 2022_2550 | 160.0 | 4641.0 | Region | RAE1 binding |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 4539_4676 | 160.0 | 4641.0 | Region | Tandem cysteine domain |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 1235_1386 | 160.0 | 4641.0 | Region | PHR domain 1 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 1726_1884 | 160.0 | 4641.0 | Region | PHR domain 2 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 2022_2550 | 160.0 | 4641.0 | Region | RAE1 binding |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 4539_4676 | 160.0 | 4641.0 | Region | Tandem cysteine domain |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 1010_1066 | 160.0 | 4641.0 | Repeat | RCC1 5 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 2341_2443 | 160.0 | 4641.0 | Repeat | Filamin |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 600_655 | 160.0 | 4641.0 | Repeat | RCC1 1 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 699_755 | 160.0 | 4641.0 | Repeat | RCC1 2 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 907_957 | 160.0 | 4641.0 | Repeat | RCC1 3 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 958_1008 | 160.0 | 4641.0 | Repeat | RCC1 4 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 1010_1066 | 160.0 | 4641.0 | Repeat | RCC1 5 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 2341_2443 | 160.0 | 4641.0 | Repeat | Filamin |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 600_655 | 160.0 | 4641.0 | Repeat | RCC1 1 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 699_755 | 160.0 | 4641.0 | Repeat | RCC1 2 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 907_957 | 160.0 | 4641.0 | Repeat | RCC1 3 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 958_1008 | 160.0 | 4641.0 | Repeat | RCC1 4 |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000357337 | - | 4 | 84 | 4428_4479 | 160.0 | 4641.0 | Zinc finger | RING-type%3B atypical |
| Hgene | MYCBP2 | chr13:77862296 | chr13:46638876 | ENST00000544440 | - | 3 | 83 | 4428_4479 | 160.0 | 4641.0 | Zinc finger | RING-type%3B atypical |
| Tgene | CPB2 | chr13:77862296 | chr13:46638876 | ENST00000181383 | 6 | 11 | 181_184 | 234.0 | 424.0 | Region | Substrate binding |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MYCBP2 | |
| CPB2 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MYCBP2-CPB2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MYCBP2-CPB2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies