| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:NBN-SLC26A7 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: NBN-SLC26A7 | FusionPDB ID: 57440 | FusionGDB2.0 ID: 57440 | Hgene | Tgene | Gene symbol | NBN | SLC26A7 | Gene ID | 9048 | 115111 |
| Gene name | artemin | solute carrier family 26 member 7 | |
| Synonyms | ART|ENOVIN|EVN|NBN | SUT2 | |
| Cytomap | 1p34.1 | 8q21.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | arteminneublastin | anion exchange transportersolute carrier family 26 (anion exchanger), member 7solute carrier family 6 member 7sulfate anion transporter | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | O60934 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000265433, ENST00000409330, | ENST00000520249, ENST00000276609, ENST00000309536, ENST00000523719, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 4=64 | 9 X 8 X 6=432 |
| # samples | 4 | 9 | |
| ** MAII score | log2(4/64*10)=-0.678071905112638 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/432*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: NBN [Title/Abstract] AND SLC26A7 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NBN(90994950)-SLC26A7(92406025), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | NBN-SLC26A7 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NBN-SLC26A7 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NBN-SLC26A7 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NBN-SLC26A7 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | SLC26A7 | GO:0006820 | anion transport | 11834742 |
| Tgene | SLC26A7 | GO:0006821 | chloride transport | 1183472 |
| Tgene | SLC26A7 | GO:0008272 | sulfate transport | 1183472 |
| Tgene | SLC26A7 | GO:0019532 | oxalate transport | 1183472 |
| Fusion gene breakpoints across NBN (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across SLC26A7 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | ESCA | TCGA-RE-A7BO-01A | NBN | chr8 | 90994950 | - | SLC26A7 | chr8 | 92406025 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000265433 | NBN | chr8 | 90994950 | - | ENST00000523719 | SLC26A7 | chr8 | 92406025 | + | 1180 | 326 | 155 | 520 | 121 |
| ENST00000265433 | NBN | chr8 | 90994950 | - | ENST00000276609 | SLC26A7 | chr8 | 92406025 | + | 3574 | 326 | 155 | 520 | 121 |
| ENST00000265433 | NBN | chr8 | 90994950 | - | ENST00000309536 | SLC26A7 | chr8 | 92406025 | + | 986 | 326 | 155 | 541 | 128 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000265433 | ENST00000523719 | NBN | chr8 | 90994950 | - | SLC26A7 | chr8 | 92406025 | + | 0.006173554 | 0.99382645 |
| ENST00000265433 | ENST00000276609 | NBN | chr8 | 90994950 | - | SLC26A7 | chr8 | 92406025 | + | 0.011585092 | 0.9884149 |
| ENST00000265433 | ENST00000309536 | NBN | chr8 | 90994950 | - | SLC26A7 | chr8 | 92406025 | + | 0.006041721 | 0.99395823 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >57440_57440_1_NBN-SLC26A7_NBN_chr8_90994950_ENST00000265433_SLC26A7_chr8_92406025_ENST00000276609_length(amino acids)=121AA_BP=57 MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDS -------------------------------------------------------------- >57440_57440_2_NBN-SLC26A7_NBN_chr8_90994950_ENST00000265433_SLC26A7_chr8_92406025_ENST00000309536_length(amino acids)=128AA_BP=57 MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDS -------------------------------------------------------------- >57440_57440_3_NBN-SLC26A7_NBN_chr8_90994950_ENST00000265433_SLC26A7_chr8_92406025_ENST00000523719_length(amino acids)=121AA_BP=57 MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDS -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:90994950/chr8:92406025) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| NBN | . |
| FUNCTION: Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. It can also recruit MRE11 and RAD50 to the proximity of DSBs by an interaction with the histone H2AX. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. The roles of NBS1/MRN encompass DNA damage sensor, signal transducer, and effector, which enable cells to maintain DNA integrity and genomic stability. Forms a complex with RBBP8 to link DNA double-strand break sensing to resection. Enhances AKT1 phosphorylation possibly by association with the mTORC2 complex. {ECO:0000269|PubMed:10888888, ECO:0000269|PubMed:15616588, ECO:0000269|PubMed:19759395, ECO:0000269|PubMed:23762398, ECO:0000269|PubMed:9705271}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 641_656 | 592.0 | 657.0 | Region | Membrane targeting | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 641_656 | 592.0 | 664.0 | Region | Membrane targeting | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 641_656 | 592.0 | 657.0 | Region | Membrane targeting |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 448_451 | 57.0 | 755.0 | Compositional bias | Note=Poly-Gln |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 448_451 | 0 | 673.0 | Compositional bias | Note=Poly-Gln |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 105_181 | 57.0 | 755.0 | Domain | Note=BRCT |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 24_83 | 57.0 | 755.0 | Domain | FHA |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 105_181 | 0 | 673.0 | Domain | Note=BRCT |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 24_83 | 0 | 673.0 | Domain | FHA |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 461_467 | 57.0 | 755.0 | Motif | Note=Nuclear localization signal |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 736_743 | 57.0 | 755.0 | Motif | Note=EEXXXDDL motif |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 461_467 | 0 | 673.0 | Motif | Note=Nuclear localization signal |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 736_743 | 0 | 673.0 | Motif | Note=EEXXXDDL motif |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 492_641 | 592.0 | 657.0 | Domain | STAS | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 492_641 | 592.0 | 664.0 | Domain | STAS | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 492_641 | 592.0 | 657.0 | Domain | STAS | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 166_166 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 188_202 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 1_75 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 224_227 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 249_254 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 276_306 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 328_343 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 365_383 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 426_448 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 470_656 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 97_144 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 166_166 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 188_202 | 592.0 | 664.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 1_75 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 224_227 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 249_254 | 592.0 | 664.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 276_306 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 328_343 | 592.0 | 664.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 365_383 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 426_448 | 592.0 | 664.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 470_656 | 592.0 | 664.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 97_144 | 592.0 | 664.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 166_166 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 188_202 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 1_75 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 224_227 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 249_254 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 276_306 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 328_343 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 365_383 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 426_448 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 470_656 | 592.0 | 657.0 | Topological domain | Cytoplasmic | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 97_144 | 592.0 | 657.0 | Topological domain | Extracellular | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 145_165 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 167_187 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 203_223 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 228_248 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 255_275 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 307_327 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 344_364 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 384_404 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 405_425 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 449_469 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000276609 | 15 | 19 | 76_96 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 145_165 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 167_187 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 203_223 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 228_248 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 255_275 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 307_327 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 344_364 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 384_404 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 405_425 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 449_469 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000309536 | 15 | 19 | 76_96 | 592.0 | 664.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 145_165 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 167_187 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 203_223 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 228_248 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 255_275 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 307_327 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 344_364 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 384_404 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 405_425 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 449_469 | 592.0 | 657.0 | Transmembrane | Helical | |
| Tgene | SLC26A7 | chr8:90994950 | chr8:92406025 | ENST00000523719 | 16 | 20 | 76_96 | 592.0 | 657.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| NBN | |
| SLC26A7 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000265433 | - | 2 | 16 | 221_402 | 57.0 | 755.0 | MTOR%2C MAPKAP1 and RICTOR |
| Hgene | NBN | chr8:90994950 | chr8:92406025 | ENST00000409330 | - | 2 | 16 | 221_402 | 0 | 673.0 | MTOR%2C MAPKAP1 and RICTOR |
Top |
Related Drugs to NBN-SLC26A7 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NBN-SLC26A7 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies