UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:NCSTN-ATP1A4 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: NCSTN-ATP1A4 | FusionPDB ID: 57901 | FusionGDB2.0 ID: 57901 | Hgene | Tgene | Gene symbol | NCSTN | ATP1A4 | Gene ID | 23385 | 480 |
Gene name | nicastrin | ATPase Na+/K+ transporting subunit alpha 4 | |
Synonyms | ATAG1874 | ATP1A1|ATP1AL2 | |
Cytomap | 1q23.2 | 1q23.2 | |
Type of gene | protein-coding | protein-coding | |
Description | nicastrinanterior pharynx-defective 2 | sodium/potassium-transporting ATPase subunit alpha-4ATPase, Na+/K+ transporting, alpha 4 polypeptideATPase, Na+/K+ transporting, alpha polypeptide-like 2Na(+)/K(+) ATPase alpha-4 subunitNa+/K+ ATPase 4Na+/K+ ATPase, alpha-D polypeptideNa,K-ATPase su | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q92542 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000294785, ENST00000368063, ENST00000392212, ENST00000535857, ENST00000368065, ENST00000459963, | ENST00000418334, ENST00000470705, ENST00000368081, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 7 X 4=168 | 2 X 2 X 2=8 |
# samples | 7 | 2 | |
** MAII score | log2(7/168*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: NCSTN [Title/Abstract] AND ATP1A4 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NCSTN(160314616)-ATP1A4(160145882), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | NCSTN-ATP1A4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NCSTN-ATP1A4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NCSTN-ATP1A4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NCSTN-ATP1A4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | NCSTN | GO:0006509 | membrane protein ectodomain proteolysis | 15274632 |
Hgene | NCSTN | GO:0016485 | protein processing | 15274632 |
Hgene | NCSTN | GO:0042982 | amyloid precursor protein metabolic process | 25043039|26280335 |
Hgene | NCSTN | GO:0043085 | positive regulation of catalytic activity | 15274632 |
Tgene | ATP1A4 | GO:0030317 | flagellated sperm motility | 12112599 |
Tgene | ATP1A4 | GO:0030641 | regulation of cellular pH | 12112599 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-BH-A1FD-01A | NCSTN | chr1 | 160314616 | - | ATP1A4 | chr1 | 160145882 | + |
ChimerDB4 | BRCA | TCGA-BH-A1FD-01A | NCSTN | chr1 | 160314616 | + | ATP1A4 | chr1 | 160145882 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000294785 | NCSTN | chr1 | 160314616 | + | ENST00000368081 | ATP1A4 | chr1 | 160145882 | + | 1372 | 315 | 125 | 1093 | 322 |
ENST00000368063 | NCSTN | chr1 | 160314616 | + | ENST00000368081 | ATP1A4 | chr1 | 160145882 | + | 1467 | 410 | 280 | 1188 | 302 |
ENST00000535857 | NCSTN | chr1 | 160314616 | + | ENST00000368081 | ATP1A4 | chr1 | 160145882 | + | 1258 | 201 | 11 | 979 | 322 |
ENST00000392212 | NCSTN | chr1 | 160314616 | + | ENST00000368081 | ATP1A4 | chr1 | 160145882 | + | 1187 | 130 | 0 | 908 | 302 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000294785 | ENST00000368081 | NCSTN | chr1 | 160314616 | + | ATP1A4 | chr1 | 160145882 | + | 0.005296152 | 0.9947038 |
ENST00000368063 | ENST00000368081 | NCSTN | chr1 | 160314616 | + | ATP1A4 | chr1 | 160145882 | + | 0.004204527 | 0.9957955 |
ENST00000535857 | ENST00000368081 | NCSTN | chr1 | 160314616 | + | ATP1A4 | chr1 | 160145882 | + | 0.005002306 | 0.99499774 |
ENST00000392212 | ENST00000368081 | NCSTN | chr1 | 160314616 | + | ATP1A4 | chr1 | 160145882 | + | 0.004287367 | 0.99571264 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >57901_57901_1_NCSTN-ATP1A4_NCSTN_chr1_160314616_ENST00000294785_ATP1A4_chr1_160145882_ENST00000368081_length(amino acids)=322AA_BP=64 MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFL MFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPV DLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYT -------------------------------------------------------------- >57901_57901_2_NCSTN-ATP1A4_NCSTN_chr1_160314616_ENST00000368063_ATP1A4_chr1_160145882_ENST00000368081_length(amino acids)=302AA_BP=44 MDFNLILESLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCID LGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDS YGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCA -------------------------------------------------------------- >57901_57901_3_NCSTN-ATP1A4_NCSTN_chr1_160314616_ENST00000392212_ATP1A4_chr1_160145882_ENST00000368081_length(amino acids)=302AA_BP=44 MDFNLILESLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCID LGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDS YGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCA -------------------------------------------------------------- >57901_57901_4_NCSTN-ATP1A4_NCSTN_chr1_160314616_ENST00000535857_ATP1A4_chr1_160145882_ENST00000368081_length(amino acids)=322AA_BP=64 MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFL MFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPV DLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:160314616/chr1:160145882) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
NCSTN | . |
FUNCTION: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (PubMed:10993067, PubMed:12679784, PubMed:25043039, PubMed:26280335, PubMed:30598546, PubMed:30630874). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels. {ECO:0000269|PubMed:10993067, ECO:0000269|PubMed:12679784, ECO:0000269|PubMed:25043039, ECO:0000269|PubMed:26280335, ECO:0000269|PubMed:30598546, ECO:0000269|PubMed:30630874}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 1013_1029 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 799_808 | 770.3333333333334 | 1030.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 830_849 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 873_924 | 770.3333333333334 | 1030.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 945_957 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 977_991 | 770.3333333333334 | 1030.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 1013_1029 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 117_139 | 0 | 166.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 161_296 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 1_95 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 317_328 | 0 | 166.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 347_778 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 799_808 | 0 | 166.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 830_849 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 873_924 | 0 | 166.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 945_957 | 0 | 166.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 977_991 | 0 | 166.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 779_798 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 809_829 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 850_872 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 925_944 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 958_976 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 992_1012 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 140_160 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 297_316 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 329_346 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 779_798 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 809_829 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 850_872 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 925_944 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 958_976 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 96_116 | 0 | 166.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000470705 | 0 | 5 | 992_1012 | 0 | 166.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000294785 | + | 2 | 17 | 34_669 | 63.333333333333336 | 710.0 | Topological domain | Extracellular |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000294785 | + | 2 | 17 | 691_709 | 63.333333333333336 | 710.0 | Topological domain | Cytoplasmic |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000368063 | + | 3 | 18 | 34_669 | 43.333333333333336 | 690.0 | Topological domain | Extracellular |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000368063 | + | 3 | 18 | 691_709 | 43.333333333333336 | 690.0 | Topological domain | Cytoplasmic |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000392212 | + | 2 | 17 | 34_669 | 43.333333333333336 | 690.0 | Topological domain | Extracellular |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000392212 | + | 2 | 17 | 691_709 | 43.333333333333336 | 690.0 | Topological domain | Cytoplasmic |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000294785 | + | 2 | 17 | 670_690 | 63.333333333333336 | 710.0 | Transmembrane | Helical |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000368063 | + | 3 | 18 | 670_690 | 43.333333333333336 | 690.0 | Transmembrane | Helical |
Hgene | NCSTN | chr1:160314616 | chr1:160145882 | ENST00000392212 | + | 2 | 17 | 670_690 | 43.333333333333336 | 690.0 | Transmembrane | Helical |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 117_139 | 770.3333333333334 | 1030.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 161_296 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 1_95 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 317_328 | 770.3333333333334 | 1030.0 | Topological domain | Extracellular | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 347_778 | 770.3333333333334 | 1030.0 | Topological domain | Cytoplasmic | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 140_160 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 297_316 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 329_346 | 770.3333333333334 | 1030.0 | Transmembrane | Helical | |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 96_116 | 770.3333333333334 | 1030.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
NCSTN | |
ATP1A4 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | ATP1A4 | chr1:160314616 | chr1:160145882 | ENST00000368081 | 14 | 22 | 90_92 | 770.3333333333334 | 1030.0 | phosphoinositide-3 kinase |
Top |
Related Drugs to NCSTN-ATP1A4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NCSTN-ATP1A4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |