UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:PDGFB-DGCR2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: PDGFB-DGCR2 | FusionPDB ID: 63834 | FusionGDB2.0 ID: 63834 | Hgene | Tgene | Gene symbol | PDGFB | DGCR2 | Gene ID | 5155 | 9993 |
Gene name | platelet derived growth factor subunit B | DiGeorge syndrome critical region gene 2 | |
Synonyms | IBGC5|PDGF-2|PDGF2|SIS|SSV|c-sis | DGS-C|IDD|LAN|SEZ-12 | |
Cytomap | 22q13.1 | 22q11.21 | |
Type of gene | protein-coding | protein-coding | |
Description | platelet-derived growth factor subunit BPDGF subunit BPDGF, B chainbecaplerminepididymis secretory sperm binding proteinplatelet-derived growth factor 2platelet-derived growth factor B chainplatelet-derived growth factor beta polypeptide (simian sa | integral membrane protein DGCR2/IDDDiGeorge syndrome critical region protein 2integral membrane protein deleted in DiGeorge syndrome | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P01127 | P98153 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000331163, ENST00000381551, | ENST00000263196, ENST00000473832, ENST00000537045, ENST00000545799, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 5 X 3=60 | 10 X 10 X 5=500 |
# samples | 5 | 11 | |
** MAII score | log2(5/60*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/500*10)=-2.18442457113743 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PDGFB [Title/Abstract] AND DGCR2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PDGFB(39626089)-DGCR2(19077003), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | PDGFB-DGCR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PDGFB-DGCR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PDGFB-DGCR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PDGFB-DGCR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PDGFB-DGCR2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. PDGFB-DGCR2 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PDGFB | GO:0001938 | positive regulation of endothelial cell proliferation | 9685360 |
Hgene | PDGFB | GO:0002548 | monocyte chemotaxis | 17991872 |
Hgene | PDGFB | GO:0006468 | protein phosphorylation | 17942966 |
Hgene | PDGFB | GO:0008284 | positive regulation of cell proliferation | 2439522|2836953|7073684 |
Hgene | PDGFB | GO:0009611 | response to wounding | 2538439 |
Hgene | PDGFB | GO:0010512 | negative regulation of phosphatidylinositol biosynthetic process | 2538439 |
Hgene | PDGFB | GO:0010544 | negative regulation of platelet activation | 2538439 |
Hgene | PDGFB | GO:0010628 | positive regulation of gene expression | 23554459|24008408 |
Hgene | PDGFB | GO:0010629 | negative regulation of gene expression | 23554459|25089138 |
Hgene | PDGFB | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling | 10734101|11788434|17942966 |
Hgene | PDGFB | GO:0014911 | positive regulation of smooth muscle cell migration | 9409235 |
Hgene | PDGFB | GO:0018105 | peptidyl-serine phosphorylation | 16530387 |
Hgene | PDGFB | GO:0018108 | peptidyl-tyrosine phosphorylation | 10734101|16530387 |
Hgene | PDGFB | GO:0030335 | positive regulation of cell migration | 11788434|21245381 |
Hgene | PDGFB | GO:0031954 | positive regulation of protein autophosphorylation | 12070119|16530387 |
Hgene | PDGFB | GO:0032091 | negative regulation of protein binding | 22619279 |
Hgene | PDGFB | GO:0032147 | activation of protein kinase activity | 16530387 |
Hgene | PDGFB | GO:0032148 | activation of protein kinase B activity | 16530387 |
Hgene | PDGFB | GO:0035655 | interleukin-18-mediated signaling pathway | 21321938 |
Hgene | PDGFB | GO:0035793 | positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway | 19019919 |
Hgene | PDGFB | GO:0043406 | positive regulation of MAP kinase activity | 9685360|11788434|16530387|17942966 |
Hgene | PDGFB | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 9685360 |
Hgene | PDGFB | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity | 16530387 |
Hgene | PDGFB | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity | 16530387 |
Hgene | PDGFB | GO:0045840 | positive regulation of mitotic nuclear division | 10644978|10734101|17942966 |
Hgene | PDGFB | GO:0045892 | negative regulation of transcription, DNA-templated | 16530387|25089138 |
Hgene | PDGFB | GO:0045893 | positive regulation of transcription, DNA-templated | 16530387|17324121 |
Hgene | PDGFB | GO:0048008 | platelet-derived growth factor receptor signaling pathway | 2439522|2536956|2836953|19088079|21245381|23554459 |
Hgene | PDGFB | GO:0048146 | positive regulation of fibroblast proliferation | 2439522|10644978|17324121 |
Hgene | PDGFB | GO:0048661 | positive regulation of smooth muscle cell proliferation | 21321938 |
Hgene | PDGFB | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 21245381 |
Hgene | PDGFB | GO:0050921 | positive regulation of chemotaxis | 9409235|19019919 |
Hgene | PDGFB | GO:0060326 | cell chemotaxis | 16014047|17991872|21245381 |
Hgene | PDGFB | GO:0061098 | positive regulation of protein tyrosine kinase activity | 16530387 |
Hgene | PDGFB | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 11788434|16530387|17942966 |
Hgene | PDGFB | GO:0071363 | cellular response to growth factor stimulus | 21245381 |
Hgene | PDGFB | GO:0072126 | positive regulation of glomerular mesangial cell proliferation | 11788434|16014047 |
Hgene | PDGFB | GO:0090280 | positive regulation of calcium ion import | 19019919 |
Hgene | PDGFB | GO:1900127 | positive regulation of hyaluronan biosynthetic process | 17324121 |
Hgene | PDGFB | GO:1902894 | negative regulation of pri-miRNA transcription by RNA polymerase II | 26493107 |
Hgene | PDGFB | GO:1902895 | positive regulation of pri-miRNA transcription by RNA polymerase II | 19088079 |
Hgene | PDGFB | GO:1904707 | positive regulation of vascular smooth muscle cell proliferation | 12070119|19088079|23554459 |
Hgene | PDGFB | GO:1904754 | positive regulation of vascular associated smooth muscle cell migration | 12070119|19088079|23554459 |
Hgene | PDGFB | GO:1905064 | negative regulation of vascular smooth muscle cell differentiation | 19088079 |
Hgene | PDGFB | GO:1905176 | positive regulation of vascular smooth muscle cell dedifferentiation | 19088079 |
Hgene | PDGFB | GO:2000379 | positive regulation of reactive oxygen species metabolic process | 19019919 |
Hgene | PDGFB | GO:2000573 | positive regulation of DNA biosynthetic process | 10644978|10734101|11788434|12070119|16530387|17942966|19019919 |
Hgene | PDGFB | GO:2000591 | positive regulation of metanephric mesenchymal cell migration | 10734101 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LGG | TCGA-TM-A84J-01A | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055737 | - |
ChimerDB4 | LGG | TCGA-TM-A84J-01A | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19077002 | - |
ChimerDB4 | LGG | TCGA-TM-A84J-01A | PDGFB | chr22 | 39626089 | - | DGCR2 | chr22 | 19077003 | - |
ChimerDB4 | LGG | TCGA-TM-A84J | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055738 | - |
ChimerDB4 | LGG | TCGA-TM-A84J | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19077003 | - |
ChimerDB4 | LGG | TCGA-TM-A84J | PDGFB | chr22 | 39626089 | - | DGCR2 | chr22 | 19077003 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000331163 | PDGFB | chr22 | 39626088 | - | ENST00000545799 | DGCR2 | chr22 | 19055738 | - | 5798 | 1389 | 1831 | 473 | 452 |
ENST00000381551 | PDGFB | chr22 | 39626088 | - | ENST00000545799 | DGCR2 | chr22 | 19055738 | - | 5002 | 593 | 19 | 1200 | 393 |
ENST00000331163 | PDGFB | chr22 | 39626088 | - | ENST00000545799 | DGCR2 | chr22 | 19055737 | - | 5798 | 1389 | 1831 | 473 | 452 |
ENST00000381551 | PDGFB | chr22 | 39626088 | - | ENST00000545799 | DGCR2 | chr22 | 19055737 | - | 5002 | 593 | 19 | 1200 | 393 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000331163 | ENST00000545799 | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055738 | - | 0.14309576 | 0.8569042 |
ENST00000381551 | ENST00000545799 | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055738 | - | 0.14971963 | 0.8502804 |
ENST00000331163 | ENST00000545799 | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055737 | - | 0.14309576 | 0.8569042 |
ENST00000381551 | ENST00000545799 | PDGFB | chr22 | 39626088 | - | DGCR2 | chr22 | 19055737 | - | 0.14971963 | 0.8502804 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >63834_63834_1_PDGFB-DGCR2_PDGFB_chr22_39626088_ENST00000331163_DGCR2_chr22_19055737_ENST00000545799_length(amino acids)=452AA_BP=0 MYHGITHTPIFECHLPATFQGAVPASDNILIANPQLALVLPTKAPLGLVPFLGQDKAQLLVSGEGGERAIQALAGLRGIPVVLPAQVDPV AAGRAFVVVPPCRALPAEANGLRHVHRVEVRRVASSGPPLPRIHSLLPMMRTHLPGHFSLLLGTPRASGHRPCSCHCLTLACQVVFQRHR GLLKDWLLPHNLDLSHLDRSQLHLGGAALHVAVVAAAGAALHLHTGRPHQEVGVGAVYEAPGDLEHLGARLALGDHGRLSNGQGTQAPSS TSQALQLASRVGAGHVQVQLGPIFLSGVSVQQALEIIKGADRVVTQHLIKLLGNGVPLGADQTQVAAERQEERPAAIHADSGPGPAGPRT RRSSAPPPRPGWGAGEGGGLGSGPRRSGAQASAAAAHPHGPRAPPPPAPAPSLGGRGGPGRRTWVRGRYLGGSRARVSIHGRGAASRTSR -------------------------------------------------------------- >63834_63834_2_PDGFB-DGCR2_PDGFB_chr22_39626088_ENST00000331163_DGCR2_chr22_19055738_ENST00000545799_length(amino acids)=452AA_BP=0 MYHGITHTPIFECHLPATFQGAVPASDNILIANPQLALVLPTKAPLGLVPFLGQDKAQLLVSGEGGERAIQALAGLRGIPVVLPAQVDPV AAGRAFVVVPPCRALPAEANGLRHVHRVEVRRVASSGPPLPRIHSLLPMMRTHLPGHFSLLLGTPRASGHRPCSCHCLTLACQVVFQRHR GLLKDWLLPHNLDLSHLDRSQLHLGGAALHVAVVAAAGAALHLHTGRPHQEVGVGAVYEAPGDLEHLGARLALGDHGRLSNGQGTQAPSS TSQALQLASRVGAGHVQVQLGPIFLSGVSVQQALEIIKGADRVVTQHLIKLLGNGVPLGADQTQVAAERQEERPAAIHADSGPGPAGPRT RRSSAPPPRPGWGAGEGGGLGSGPRRSGAQASAAAAHPHGPRAPPPPAPAPSLGGRGGPGRRTWVRGRYLGGSRARVSIHGRGAASRTSR -------------------------------------------------------------- >63834_63834_3_PDGFB-DGCR2_PDGFB_chr22_39626088_ENST00000381551_DGCR2_chr22_19055737_ENST00000545799_length(amino acids)=393AA_BP=191 MSRNGEMFIMGLGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKT RTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV TRSPGGSQEQREVTGEVRPHHGKEAVDPRQGRARGGDPSHFHAVNVAQPVRFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLN GSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKDWGVSDTMVHRRLLCPCVGTLHTHLKLGARF -------------------------------------------------------------- >63834_63834_4_PDGFB-DGCR2_PDGFB_chr22_39626088_ENST00000381551_DGCR2_chr22_19055738_ENST00000545799_length(amino acids)=393AA_BP=191 MSRNGEMFIMGLGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKT RTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV TRSPGGSQEQREVTGEVRPHHGKEAVDPRQGRARGGDPSHFHAVNVAQPVRFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLN GSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKDWGVSDTMVHRRLLCPCVGTLHTHLKLGARF -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr22:39626089/chr22:19077003) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
PDGFB | DGCR2 |
FUNCTION: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed:26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity). {ECO:0000250|UniProtKB:P31240, ECO:0000269|PubMed:26599395}. | FUNCTION: Putative adhesion receptor, that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 115_241 | 67.33333333333333 | 551.0 | Domain | C-type lectin | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 270_333 | 67.33333333333333 | 551.0 | Domain | Note=VWFC | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 115_241 | 26.333333333333332 | 510.0 | Domain | C-type lectin | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 270_333 | 26.333333333333332 | 510.0 | Domain | Note=VWFC | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 28_68 | 26.333333333333332 | 510.0 | Domain | LDL-receptor class A | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 115_241 | 67.33333333333333 | 551.0 | Domain | C-type lectin | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 270_333 | 67.33333333333333 | 551.0 | Domain | Note=VWFC | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 115_241 | 26.333333333333332 | 510.0 | Domain | C-type lectin | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 270_333 | 26.333333333333332 | 510.0 | Domain | Note=VWFC | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 28_68 | 26.333333333333332 | 510.0 | Domain | LDL-receptor class A | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 369_550 | 67.33333333333333 | 551.0 | Topological domain | Cytoplasmic | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 369_550 | 26.333333333333332 | 510.0 | Topological domain | Cytoplasmic | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 369_550 | 67.33333333333333 | 551.0 | Topological domain | Cytoplasmic | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 369_550 | 26.333333333333332 | 510.0 | Topological domain | Cytoplasmic | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 350_368 | 67.33333333333333 | 551.0 | Transmembrane | Helical | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 350_368 | 26.333333333333332 | 510.0 | Transmembrane | Helical | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 350_368 | 67.33333333333333 | 551.0 | Transmembrane | Helical | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 350_368 | 26.333333333333332 | 510.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 28_68 | 67.33333333333333 | 551.0 | Domain | LDL-receptor class A | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 28_68 | 67.33333333333333 | 551.0 | Domain | LDL-receptor class A | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000263196 | 1 | 10 | 21_349 | 67.33333333333333 | 551.0 | Topological domain | Extracellular | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055737 | ENST00000537045 | 0 | 9 | 21_349 | 26.333333333333332 | 510.0 | Topological domain | Extracellular | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000263196 | 1 | 10 | 21_349 | 67.33333333333333 | 551.0 | Topological domain | Extracellular | |
Tgene | DGCR2 | chr22:39626088 | chr22:19055738 | ENST00000537045 | 0 | 9 | 21_349 | 26.333333333333332 | 510.0 | Topological domain | Extracellular |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
PDGFB | ![]() |
DGCR2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PDGFB-DGCR2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PDGFB-DGCR2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | PDGFB | C3809645 | BASAL GANGLIA CALCIFICATION, IDIOPATHIC, 5 | 5 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | PDGFB | C0393590 | Fahr's syndrome (disorder) | 3 | GENOMICS_ENGLAND;ORPHANET |
Hgene | PDGFB | C0004782 | Basal Ganglia Diseases | 1 | CTD_human |
Hgene | PDGFB | C0006663 | Calcinosis | 1 | CTD_human |
Hgene | PDGFB | C0015371 | Extrapyramidal Disorders | 1 | CTD_human |
Hgene | PDGFB | C0016059 | Fibrosis | 1 | CTD_human |
Hgene | PDGFB | C0017566 | Gingival Hyperplasia | 1 | CTD_human |
Hgene | PDGFB | C0025286 | Meningioma | 1 | ORPHANET |
Hgene | PDGFB | C0034069 | Pulmonary Fibrosis | 1 | CTD_human |
Hgene | PDGFB | C0035309 | Retinal Diseases | 1 | CTD_human |
Hgene | PDGFB | C0040028 | Thrombocythemia, Essential | 1 | CTD_human |
Hgene | PDGFB | C0263628 | Tumoral calcinosis | 1 | CTD_human |
Hgene | PDGFB | C0521174 | Microcalcification | 1 | CTD_human |
Hgene | PDGFB | C0750951 | Lenticulostriate Disorders | 1 | CTD_human |
Hgene | PDGFB | C1623038 | Cirrhosis | 1 | CTD_human |
Hgene | PDGFB | C2239176 | Liver carcinoma | 1 | CTD_human |
Hgene | PDGFB | C3489628 | Thrombocytosis, Autosomal Dominant | 1 | CTD_human |
Hgene | PDGFB | C4551624 | Idiopathic basal ganglia calcification 1 | 1 | CTD_human |
Hgene | PDGFB | C4721507 | Alveolitis, Fibrosing | 1 | CTD_human |