UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:RNF216-JAZF1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: RNF216-JAZF1 | FusionPDB ID: 75012 | FusionGDB2.0 ID: 75012 | Hgene | Tgene | Gene symbol | RNF216 | JAZF1 | Gene ID | 54476 | 221895 |
Gene name | ring finger protein 216 | JAZF zinc finger 1 | |
Synonyms | CAHH|TRIAD3|U7I1|UBCE7IP1|ZIN | TIP27|ZNF802 | |
Cytomap | 7p22.1 | 7p15.2-p15.1 | |
Type of gene | protein-coding | protein-coding | |
Description | E3 ubiquitin-protein ligase RNF216RING-type E3 ubiquitin transferase RNF216triad domain-containing protein 3ubiquitin-conjugating enzyme 7-interacting protein 1zinc finger protein inhibiting NF-kappa-B | juxtaposed with another zinc finger protein 1TAK1-interacting protein 27juxtaposed with another zinc finger gene 1zinc finger protein 802 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9NWF9 | Q86VZ6 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000389902, ENST00000425013, ENST00000469375, | ENST00000466516, ENST00000283928, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 13 X 9=1404 | 9 X 6 X 5=270 |
# samples | 15 | 9 | |
** MAII score | log2(15/1404*10)=-3.22650852980868 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/270*10)=-1.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: RNF216 [Title/Abstract] AND JAZF1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | RNF216(5680785)-JAZF1(28031600), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | RNF216-JAZF1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. RNF216-JAZF1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. RNF216-JAZF1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. RNF216-JAZF1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | RNF216 | GO:0032648 | regulation of interferon-beta production | 19893624 |
Hgene | RNF216 | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | 19893624 |
Hgene | RNF216 | GO:0050691 | regulation of defense response to virus by host | 19893624 |
Hgene | RNF216 | GO:0070936 | protein K48-linked ubiquitination | 19893624 |
Tgene | JAZF1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 15302918 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-69-7980-01A | RNF216 | chr7 | 5680785 | - | JAZF1 | chr7 | 28031600 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000425013 | RNF216 | chr7 | 5680785 | - | ENST00000283928 | JAZF1 | chr7 | 28031600 | - | 5280 | 2436 | 213 | 2456 | 747 |
ENST00000389902 | RNF216 | chr7 | 5680785 | - | ENST00000283928 | JAZF1 | chr7 | 28031600 | - | 5494 | 2650 | 256 | 2670 | 804 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000425013 | ENST00000283928 | RNF216 | chr7 | 5680785 | - | JAZF1 | chr7 | 28031600 | - | 0.000640011 | 0.99936 |
ENST00000389902 | ENST00000283928 | RNF216 | chr7 | 5680785 | - | JAZF1 | chr7 | 28031600 | - | 0.000633461 | 0.9993666 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >75012_75012_1_RNF216-JAZF1_RNF216_chr7_5680785_ENST00000389902_JAZF1_chr7_28031600_ENST00000283928_length(amino acids)=804AA_BP= MHLKMEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTETNKPQRSRPNLIKPAAQWQ DLKRLGEERPKKSRAAFESDKSSYFSVCNNPLFDSGAQDDSEDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQ KVIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQ HEFPGPAFPRPEPQQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVDQELVELLVKETEARFPDVA NGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQD IKWALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQ EFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFP TSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKY -------------------------------------------------------------- >75012_75012_2_RNF216-JAZF1_RNF216_chr7_5680785_ENST00000425013_JAZF1_chr7_28031600_ENST00000283928_length(amino acids)=747AA_BP= MHLKMEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTEDDSEDDYGEFLDLGPPGIS EFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQKVIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHP YFQSLNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFPRPEPQQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEP NLENIWGQEAAEVDQELVELLVKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKID FFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGD IKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLF CKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNP HCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:5680785/chr7:28031600) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
RNF216 | JAZF1 |
FUNCTION: Isoform 1 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Promotes degradation of TRAF3, TLR4 and TLR9. Contributes to the regulation of antiviral responses. Down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production. Isoform 3 inhibits TNF and IL-1 mediated activation of NF-kappa-B. Promotes TNF and RIP mediated apoptosis. {ECO:0000269|PubMed:15107846, ECO:0000269|PubMed:19893624}. | FUNCTION: Acts as a transcriptional corepressor of orphan nuclear receptor NR2C2 (PubMed:15302918). Inhibits expression of the gluconeogenesis enzyme PCK2 through inhibition of NR2C2 activity (By similarity). Also involved in transcriptional activation of NAMPT by promoting expression of PPARA and PPARD (By similarity). Plays a role in lipid metabolism by suppressing lipogenesis, increasing lipolysis and decreasing lipid accumulation in adipose tissue (By similarity). Plays a role in glucose homeostasis by improving glucose metabolism and insulin sensitivity (By similarity). {ECO:0000250|UniProtKB:Q80ZQ5, ECO:0000269|PubMed:15302918}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 475_491 | 794.0 | 924.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 737_763 | 794.0 | 924.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 475_491 | 737.0 | 867.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 511_728 | 794.0 | 924.0 | Region | TRIAD supradomain |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 511_728 | 737.0 | 867.0 | Region | TRIAD supradomain |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 515_564 | 794.0 | 924.0 | Zinc finger | RING-type 1 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 583_648 | 794.0 | 924.0 | Zinc finger | IBR-type |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 675_703 | 794.0 | 924.0 | Zinc finger | RING-type 2%3B atypical |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 515_564 | 737.0 | 867.0 | Zinc finger | RING-type 1 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 583_648 | 737.0 | 867.0 | Zinc finger | IBR-type |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 675_703 | 737.0 | 867.0 | Zinc finger | RING-type 2%3B atypical |
Tgene | JAZF1 | chr7:5680785 | chr7:28031600 | ENST00000283928 | 0 | 5 | 173_198 | 38.333333333333336 | 244.0 | Zinc finger | Note=C2H2-type 2 | |
Tgene | JAZF1 | chr7:5680785 | chr7:28031600 | ENST00000283928 | 0 | 5 | 208_230 | 38.333333333333336 | 244.0 | Zinc finger | Note=C2H2-type 3%3B degenerate |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 737_763 | 737.0 | 867.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000389902 | - | 15 | 17 | 769_862 | 794.0 | 924.0 | Compositional bias | Note=Pro-rich |
Hgene | RNF216 | chr7:5680785 | chr7:28031600 | ENST00000425013 | - | 15 | 17 | 769_862 | 737.0 | 867.0 | Compositional bias | Note=Pro-rich |
Tgene | JAZF1 | chr7:5680785 | chr7:28031600 | ENST00000283928 | 0 | 5 | 12_37 | 38.333333333333336 | 244.0 | Zinc finger | Note=C2H2-type 1 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
JAZF1 | NR2C2, PPARG, RXRA, YEATS4, TRRAP, Ruvbl1, MEAF6, RUVBL1, MYCL, HIST1H2BA, MORF4L2, HIST1H4A, FAM9B, BRD8, SUZ12, KAT5, EP400, DMAP1, EPC1, EPC2, MBTD1, MRGBP, DDX39A, NR2C1, METAP2, CLTCL1, H2AFZ, VPS72, ACAD11, ING3, ING5, |
![]() |
Gene | STRING network |
RNF216 | ![]() |
JAZF1 | ![]() |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to RNF216-JAZF1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to RNF216-JAZF1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | RNF216 | C1859305 | Cerebellar Ataxia and Hypogonadotropic Hypogonadism | 2 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | JAZF1 | C0011860 | Diabetes Mellitus, Non-Insulin-Dependent | 1 | CTD_human |
Tgene | JAZF1 | C0014170 | Endometrial Neoplasms | 1 | CTD_human |
Tgene | JAZF1 | C0024141 | Lupus Erythematosus, Systemic | 1 | CTD_human;ORPHANET |
Tgene | JAZF1 | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
Tgene | JAZF1 | C0206630 | Endometrial Stromal Sarcoma | 1 | ORPHANET |
Tgene | JAZF1 | C0242380 | Libman-Sacks Disease | 1 | CTD_human |
Tgene | JAZF1 | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
Tgene | JAZF1 | C0476089 | Endometrial Carcinoma | 1 | CTD_human |