| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:SEMA3C-CD36 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: SEMA3C-CD36 | FusionPDB ID: 80278 | FusionGDB2.0 ID: 80278 | Hgene | Tgene | Gene symbol | SEMA3C | CD36 | Gene ID | 10512 | 948 |
| Gene name | semaphorin 3C | CD36 molecule | |
| Synonyms | SEMAE|SemE | BDPLT10|CHDS7|FAT|GP3B|GP4|GPIV|PASIV|SCARB3 | |
| Cytomap | 7q21.11 | 7q21.11 | |
| Type of gene | protein-coding | protein-coding | |
| Description | semaphorin-3Csema Esema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Csemaphorin E | platelet glycoprotein 4CD36 antigen (collagen type I receptor, thrombospondin receptor)CD36 molecule (thrombospondin receptor)GPIIIBPAS IVPAS-4 proteincluster determinant 36fatty acid translocaseglycoprotein IIIbleukocyte differentiation antigen | |
| Modification date | 20200313 | 20200322 | |
| UniProtAcc | . | P16671 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000265361, ENST00000419255, ENST00000536800, ENST00000544525, ENST00000487621, | ENST00000435819, ENST00000309881, ENST00000394788, ENST00000432207, ENST00000433696, ENST00000441109, ENST00000447544, ENST00000534394, ENST00000538969, ENST00000544133, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 5 X 5=175 | 5 X 6 X 4=120 |
| # samples | 8 | 6 | |
| ** MAII score | log2(8/175*10)=-1.12928301694497 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/120*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: SEMA3C [Title/Abstract] AND CD36 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | SEMA3C(80545995)-CD36(80115783), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | SEMA3C-CD36 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. SEMA3C-CD36 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. SEMA3C-CD36 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. SEMA3C-CD36 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. SEMA3C-CD36 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. SEMA3C-CD36 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | CD36 | GO:0001954 | positive regulation of cell-matrix adhesion | 17416590 |
| Tgene | CD36 | GO:0007263 | nitric oxide mediated signal transduction | 17416590 |
| Tgene | CD36 | GO:0019934 | cGMP-mediated signaling | 17416590 |
| Tgene | CD36 | GO:0044539 | long-chain fatty acid import | 17416590|22022213 |
| Tgene | CD36 | GO:0071726 | cellular response to diacyl bacterial lipopeptide | 16880211 |
| Fusion gene breakpoints across SEMA3C (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CD36 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BLCA | TCGA-GV-A3QF-01A | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
| ChimerDB4 | LUSC | TCGA-22-5492-01A | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000435819 | CD36 | chr7 | 80293722 | + | 1737 | 665 | 659 | 1474 | 271 |
| ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000309881 | CD36 | chr7 | 80293722 | + | 1737 | 665 | 659 | 1474 | 271 |
| ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000534394 | CD36 | chr7 | 80293722 | + | 1744 | 665 | 659 | 1474 | 271 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000265361 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000969141 | 0.9990308 |
| ENST00000265361 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000969141 | 0.9990308 |
| ENST00000265361 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000955787 | 0.99904424 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >80278_80278_1_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000309881_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- >80278_80278_2_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000435819_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- >80278_80278_3_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000534394_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:80545995/chr7:80115783) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | CD36 |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity) (PubMed:18353783, PubMed:21610069). In the small intestine, plays a role in proximal absorption of dietary fatty acid and cholesterol for optimal chylomicron formation, possibly through the activation of MAPK1/3 (ERK1/2) signaling pathway (By similarity) (PubMed:18753675). Involved in oral fat perception and preferences (PubMed:22240721, PubMed:25822988). Detection into the tongue of long-chain fatty acids leads to a rapid and sustained rise in flux and protein content of pancreatobiliary secretions (By similarity). In taste receptor cells, mediates the induction of an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons in the nucleus of the solitary tract (By similarity). Important factor in both ventromedial hypothalamus neuronal sensing of long-chain fatty acid and the regulation of energy and glucose homeostasis (By similarity). Receptor for thombospondins, THBS1 and THBS2, mediating their antiangiogenic effects (By similarity). As a coreceptor for TLR4:TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, interacts with the heterodimer TLR4:TLR6, the complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion, through the priming and activation of the NLRP3 inflammasome (By similarity) (PubMed:20037584). Selective and nonredundant sensor of microbial diacylated lipopeptide that signal via TLR2:TLR6 heterodimer, this cluster triggers signaling from the cell surface, leading to the NF-kappa-B-dependent production of TNF, via MYD88 signaling pathway and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (By similarity) (PubMed:16880211). {ECO:0000250|UniProtKB:Q07969, ECO:0000250|UniProtKB:Q08857, ECO:0000269|PubMed:16880211, ECO:0000269|PubMed:18353783, ECO:0000269|PubMed:18753675, ECO:0000269|PubMed:20037584, ECO:0000269|PubMed:21395585, ECO:0000269|PubMed:21610069, ECO:0000269|PubMed:22240721, ECO:0000269|PubMed:25822988, ECO:0000305|PubMed:19471024}.; FUNCTION: (Microbial infection) Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling. {ECO:0000269|PubMed:10890433, ECO:0000269|PubMed:12506336, ECO:0000269|PubMed:19864601}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 440_461 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 440_461 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 440_461 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 440_461 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 440_461 | 203.0 | 657.6666666666666 | Transmembrane | Helical |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 724_745 | 34.333333333333336 | 752.0 | Compositional bias | Note=Arg/Lys-rich (basic) |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 724_745 | 34.333333333333336 | 752.0 | Compositional bias | Note=Arg/Lys-rich (basic) |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 28_511 | 34.333333333333336 | 752.0 | Domain | Sema |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 571_655 | 34.333333333333336 | 752.0 | Domain | Note=Ig-like C2-type |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 28_511 | 34.333333333333336 | 752.0 | Domain | Sema |
| Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 571_655 | 34.333333333333336 | 752.0 | Domain | Note=Ig-like C2-type |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 2_7 | 203.0 | 473.0 | Topological domain | Cytoplasmic | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 30_439 | 203.0 | 473.0 | Topological domain | Extracellular | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 2_7 | 203.0 | 473.0 | Topological domain | Cytoplasmic | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 30_439 | 203.0 | 473.0 | Topological domain | Extracellular | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 2_7 | 203.0 | 473.0 | Topological domain | Cytoplasmic | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 30_439 | 203.0 | 473.0 | Topological domain | Extracellular | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 2_7 | 203.0 | 473.0 | Topological domain | Cytoplasmic | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 30_439 | 203.0 | 473.0 | Topological domain | Extracellular | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 2_7 | 203.0 | 657.6666666666666 | Topological domain | Cytoplasmic | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 30_439 | 203.0 | 657.6666666666666 | Topological domain | Extracellular | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 8_29 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 8_29 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 8_29 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 8_29 | 203.0 | 473.0 | Transmembrane | Helical | |
| Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 8_29 | 203.0 | 657.6666666666666 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| SEMA3C | |
| CD36 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to SEMA3C-CD36 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to SEMA3C-CD36 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies