UTHEALTH HOME    ABOUT SBMI    A-Z    WEBMAIL    INSIDE THE UNIVERSITY
FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Terms of Use

Center for Computational Systems Medicine level1
leaf

Fusion Gene Summary

leaf

Fusion Gene Sample Information

leaf

Fusion ORF Analysis

leaf

Fusion Amino Acid Sequences

leaf

Fusion Protein Functional Features

leaf

Fusion Protein-Protein Interaction

leaf

Related drugs with this fusion protein

leaf

Related disease with this fusion protein

Fusion Protein:ATRX-MAGT1

Fusion Protein Summary

check button Fusion gene summary
Fusion partner gene informationFusion gene name: ATRX-MAGT1
FusionPDB ID: 8356
FusionGDB2.0 ID: 8356
HgeneTgene
Gene symbol

ATRX

MAGT1

Gene ID

546

84061

Gene nameATRX chromatin remodelermagnesium transporter 1
SynonymsJMS|MRX52|RAD54|RAD54L|XH2|XNP|ZNF-HXCDG1CC|IAP|MRX95|OST3B|PRO0756|SLC58A1|XMEN|bA217H1.1
Cytomap

Xq21.1

Xq21.1

Type of geneprotein-codingprotein-coding
Descriptiontranscriptional regulator ATRXATP-dependent helicase ATRXX-linked helicase IIX-linked nuclear proteinalpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae)magnesium transporter protein 1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1implantation-associated proteinoligosaccharyl transferase subunit MAGT1oligosaccharyltransferase 3 homolog B
Modification date2020031320200327
UniProtAcc

P46100

Q9H0U3

Ensembl transtripts involved in fusion geneENST idsENST00000373341, ENST00000373344, 
ENST00000395603, ENST00000480283, 
ENST00000373336, ENST00000358075, 
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0)* DoF score17 X 13 X 9=19897 X 7 X 4=196
# samples 238
** MAII scorelog2(23/1989*10)=-3.11233750988937
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/196*10)=-1.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context (manual curation of fusion genes in FusionPDB)

PubMed: ATRX [Title/Abstract] AND MAGT1 [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0)ATRX(76972608)-MAGT1(77112994), # samples:1
ATRX(76733729)-MAGT1(77116313), # samples:1
MAGT1(77150806)-ATRX(76972720), # samples:1
MAGT1(77096743)-ATRX(76876000), # samples:1
MAGT1(77150806)-ATRX(76872198), # samples:1
Anticipated loss of major functional domain due to fusion event.ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF.
ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF.
MAGT1-ATRX seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF.
MAGT1-ATRX seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF.
ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF.
ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF.
ATRX-MAGT1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF.
MAGT1-ATRX seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF.
MAGT1-ATRX seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF.
MAGT1-ATRX seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneATRX

GO:0006334

nucleosome assembly

20651253

HgeneATRX

GO:0006338

chromatin remodeling

20651253


check buttonFusion gene breakpoints across ATRX (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check buttonFusion gene breakpoints across MAGT1 (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure


Top

Fusion Gene Sample Information

check buttonFusion gene information from FusionGDB2.0.
check button Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
SourceDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDB4SKCMTCGA-ER-A3ES-06AATRXchrX

76972608

-MAGT1chrX

77112994

-
ChiTaRS5.0N/ABF337151ATRXchrX

76733729

-MAGT1chrX

77116313

-


Top

Fusion ORF Analysis


check buttonFusion information from ORFfinder translation from full-length transcript sequence from FusionPDB.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandSeq length
(transcript)
BP loci
(transcript)
Predicted start
(transcript)
Predicted stop
(transcript)
Seq length
(amino acids)
ENST00000373341ATRXchrX76972608-ENST00000358075MAGT1chrX77112994-3587113119730203

check buttonDeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandNo-coding scoreCoding score
ENST00000373341ENST00000358075ATRXchrX76972608-MAGT1chrX77112994-0.0047657730.9952342

Top

Fusion Amino Acid Sequences


check button For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones.
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP

>8356_8356_1_ATRX-MAGT1_ATRX_chrX_76972608_ENST00000373341_MAGT1_chrX_77112994_ENST00000358075_length(amino acids)=203AA_BP=0
MNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFA
ALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVL

--------------------------------------------------------------

Top

Fusion Protein Functional Features


check button Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chrX:76972608/chrX:77112994)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.
FGviewer

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATRX

P46100

MAGT1

Q9H0U3

FUNCTION: Involved in transcriptional regulation and chromatin remodeling. Facilitates DNA replication in multiple cellular environments and is required for efficient replication of a subset of genomic loci. Binds to DNA tandem repeat sequences in both telomeres and euchromatin and in vitro binds DNA quadruplex structures. May help stabilizing G-rich regions into regular chromatin structures by remodeling G4 DNA and incorporating H3.3-containing nucleosomes. Catalytic component of the chromatin remodeling complex ATRX:DAXX which has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats outside S-phase and telomeres, and the in vitro remodeling of H3.3-containing nucleosomes. Its heterochromatin targeting is proposed to involve a combinatorial readout of histone H3 modifications (specifically methylation states of H3K9 and H3K4) and association with CBX5. Involved in maintaining telomere structural integrity in embryonic stem cells which probably implies recruitment of CBX5 to telomeres. Reports on the involvement in transcriptional regulation of telomeric repeat-containing RNA (TERRA) are conflicting; according to a report, it is not sufficient to decrease chromatin condensation at telomeres nor to increase expression of telomeric RNA in fibroblasts (PubMed:24500201). May be involved in telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines. Acts as negative regulator of chromatin incorporation of transcriptionally repressive histone MACROH2A1, particularily at telomeres and the alpha-globin cluster in erythroleukemic cells. Participates in the allele-specific gene expression at the imprinted IGF2/H19 gene locus. On the maternal allele, required for the chromatin occupancy of SMC1 and CTCTF within the H19 imprinting control region (ICR) and involved in esatblishment of histone tails modifications in the ICR. May be involved in brain development and facial morphogenesis. Binds to zinc-finger coding genes with atypical chromatin signatures and regulates its H3K9me3 levels. Forms a complex with ZNF274, TRIM28 and SETDB1 to facilitate the deposition and maintenance of H3K9me3 at the 3' exons of zinc-finger genes (PubMed:27029610). {ECO:0000269|PubMed:12953102, ECO:0000269|PubMed:14990586, ECO:0000269|PubMed:20504901, ECO:0000269|PubMed:20651253, ECO:0000269|PubMed:21029860, ECO:0000269|PubMed:22391447, ECO:0000269|PubMed:22829774, ECO:0000269|PubMed:24500201, ECO:0000269|PubMed:27029610}.FUNCTION: Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues; in this function seems to act redundantly with TUSC3. In its oxidized form proposed to form transient mixed disulfides with a glycoprotein substrate to facilitate access of STT3B to the unmodified acceptor site. Has also oxidoreductase-independent functions in the STT3B-containing OST complex possibly involving substrate recognition. {ECO:0000269|PubMed:25135935, ECO:0000269|PubMed:26864433, ECO:0000269|PubMed:31036665, ECO:0000305}.; FUNCTION: May be involved in Mg(2+) transport in epithelial cells. {ECO:0000305|PubMed:15804357, ECO:0000305|PubMed:19717468}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

* Minus value of BPloci means that the break pointn is located before the CDS.
- Retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210206_209162.0368.0Topological domainCytoplasmic
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210231_270162.0368.0Topological domainExtracellular
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210292_300162.0368.0Topological domainCytoplasmic
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210322_335162.0368.0Topological domainExtracellular
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210185_205162.0368.0TransmembraneHelical
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210210_230162.0368.0TransmembraneHelical
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210271_291162.0368.0TransmembraneHelical
TgeneMAGT1chrX:76972608chrX:77112994ENST00000358075210301_321162.0368.0TransmembraneHelical

- Not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351151_115644.3333333333333362493.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351166_116944.3333333333333362493.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351202_120644.3333333333333362493.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351259_126644.3333333333333362493.0Compositional biasNote=Poly-Asp
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351443_146644.3333333333333362493.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351499_150244.3333333333333362493.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351929_193944.3333333333333362493.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351941_194844.3333333333333362493.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2352222_222544.3333333333333362493.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2352262_226544.3333333333333362493.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2352420_242544.3333333333333362493.0Compositional biasNote=Poly-Gln
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-235745_75044.3333333333333362493.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341151_115644.3333333333333362455.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341166_116944.3333333333333362455.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341202_120644.3333333333333362455.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341259_126644.3333333333333362455.0Compositional biasNote=Poly-Asp
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341443_146644.3333333333333362455.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341499_150244.3333333333333362455.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341929_193944.3333333333333362455.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341941_194844.3333333333333362455.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2342222_222544.3333333333333362455.0Compositional biasNote=Poly-Lys
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2342262_226544.3333333333333362455.0Compositional biasNote=Poly-Glu
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2342420_242544.3333333333333362455.0Compositional biasNote=Poly-Gln
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-234745_75044.3333333333333362455.0Compositional biasNote=Poly-Ser
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351581_176844.3333333333333362493.0DomainHelicase ATP-binding
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-235159_29644.3333333333333362493.0DomainADD
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2352025_220544.3333333333333362493.0DomainHelicase C-terminal
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341581_176844.3333333333333362455.0DomainHelicase ATP-binding
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-234159_29644.3333333333333362455.0DomainADD
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2342025_220544.3333333333333362455.0DomainHelicase C-terminal
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351719_172244.3333333333333362493.0MotifNote=DEGH box
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-235581_59444.3333333333333362493.0MotifNote=PxVxL motif
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341719_172244.3333333333333362455.0MotifNote=DEGH box
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-234581_59444.3333333333333362455.0MotifNote=PxVxL motif
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351594_160144.3333333333333362493.0Nucleotide bindingATP
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341594_160144.3333333333333362455.0Nucleotide bindingATP
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-235170_20644.3333333333333362493.0Zinc fingerGATA-type%3B atypical
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-235217_27244.3333333333333362493.0Zinc fingerPHD-type%3B atypical
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-234170_20644.3333333333333362455.0Zinc fingerGATA-type%3B atypical
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-234217_27244.3333333333333362455.0Zinc fingerPHD-type%3B atypical
TgeneMAGT1chrX:76972608chrX:77112994ENST0000035807521047_175162.0368.0DomainNote=Thioredoxin
TgeneMAGT1chrX:76972608chrX:77112994ENST0000035807521030_184162.0368.0Topological domainExtracellular


Top

Fusion Protein-Protein Interaction


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page.


check button Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160)
GenePPI interactors


check button Protein-protein interactors based on sequence similarity (STRING)
GeneSTRING network
ATRX
MAGT1


check button - Retained interactions in fusion protein (protein functional feature from UniProt).
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost interactions due to fusion (protein functional feature from UniProt).
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2351189_132644.3333333333333362493.0DAXX
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2341189_132644.3333333333333362455.0DAXX
HgeneATRXchrX:76972608chrX:77112994ENST00000373344-2352010_228044.3333333333333362493.0MECP2
HgeneATRXchrX:76972608chrX:77112994ENST00000395603-2342010_228044.3333333333333362455.0MECP2


Top

Related Drugs to ATRX-MAGT1


check button Drugs used for this fusion-positive patient.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)
HgeneTgeneDrugSourcePMID

Top

Related Diseases to ATRX-MAGT1


check button Diseases that have this fusion gene.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)
HgeneTgeneDiseaseSourcePMID

check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource