UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:TES-CAV1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: TES-CAV1 | FusionPDB ID: 90116 | FusionGDB2.0 ID: 90116 | Hgene | Tgene | Gene symbol | TES | CAV1 | Gene ID | 26136 | 857 |
Gene name | testin LIM domain protein | caveolin 1 | |
Synonyms | TESS|TESS-2 | BSCL3|CGL3|LCCNS|MSTP085|PPH3|VIP21 | |
Cytomap | 7q31.2 | 7q31.2 | |
Type of gene | protein-coding | protein-coding | |
Description | testintestis derived transcript (3 LIM domains) | caveolin-1caveolin 1, caveolae protein, 22kDacell growth-inhibiting protein 32 | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | PRSS21 | Q03135 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000358204, ENST00000537767, ENST00000393481, ENST00000485009, | ENST00000393467, ENST00000393468, ENST00000405348, ENST00000393470, ENST00000341049, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 7 X 4=280 | 11 X 9 X 7=693 |
# samples | 9 | 14 | |
** MAII score | log2(9/280*10)=-1.63742992061529 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(14/693*10)=-2.30742852519225 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: TES [Title/Abstract] AND CAV1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TES(115850788)-CAV1(116166579), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | TES-CAV1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TES-CAV1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TES-CAV1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TES-CAV1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CAV1 | GO:0009617 | response to bacterium | 24625804 |
Tgene | CAV1 | GO:0010875 | positive regulation of cholesterol efflux | 24576892 |
Tgene | CAV1 | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | 25893292 |
Tgene | CAV1 | GO:0031295 | T cell costimulation | 17287217 |
Tgene | CAV1 | GO:0031623 | receptor internalization | 25893292 |
Tgene | CAV1 | GO:0032091 | negative regulation of protein binding | 16890161 |
Tgene | CAV1 | GO:0032570 | response to progesterone | 12388746 |
Tgene | CAV1 | GO:0033137 | negative regulation of peptidyl-serine phosphorylation | 18081315 |
Tgene | CAV1 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 18081315 |
Tgene | CAV1 | GO:0043627 | response to estrogen | 12388746 |
Tgene | CAV1 | GO:0051480 | regulation of cytosolic calcium ion concentration | 19052258 |
Tgene | CAV1 | GO:0072584 | caveolin-mediated endocytosis | 19931615 |
Tgene | CAV1 | GO:1900027 | regulation of ruffle assembly | 24625804 |
Tgene | CAV1 | GO:2000535 | regulation of entry of bacterium into host cell | 24625804 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-D7-8576-01A | TES | chr7 | 115850788 | + | CAV1 | chr7 | 116166579 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000358204 | TES | chr7 | 115850788 | + | ENST00000341049 | CAV1 | chr7 | 116166579 | + | 2638 | 242 | 5 | 748 | 247 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000358204 | ENST00000341049 | TES | chr7 | 115850788 | + | CAV1 | chr7 | 116166579 | + | 0.001044734 | 0.99895525 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >90116_90116_1_TES-CAV1_TES_chr7_115850788_ENST00000358204_CAV1_chr7_116166579_ENST00000341049_length(amino acids)=247AA_BP=1 MPGPLCSRVRAAGPLRRTGRRKFDGAGRVAVERRRGSSAGFPCSQRSRRPAEPGRGIPDRRRRGPIGRVNMDLENKVKKGHLYTVPIREQ GNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPM -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:115850788/chr7:116166579) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
TES | CAV1 |
314 | FUNCTION: May act as a scaffolding protein within caveolar membranes (PubMed:11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed:19262564). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (PubMed:17287217). Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (PubMed:25893292). {ECO:0000250|UniProtKB:P49817, ECO:0000269|PubMed:11751885, ECO:0000269|PubMed:17287217, ECO:0000269|PubMed:19262564, ECO:0000269|PubMed:25893292}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 105_125 | 10.0 | 179.0 | Intramembrane | Helical | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 105_125 | 0 | 148.0 | Intramembrane | Helical | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 105_125 | 0 | 148.0 | Intramembrane | Helical | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 105_125 | 0 | 148.0 | Intramembrane | Helical | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 131_142 | 10.0 | 179.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 149_160 | 10.0 | 179.0 | Region | Interacts with SPRY1%2C SPRY2%2C and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 167_178 | 10.0 | 179.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 131_142 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 149_160 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 167_178 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 2_94 | 0 | 148.0 | Region | Required for homooligomerization | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 131_142 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 149_160 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 167_178 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 2_94 | 0 | 148.0 | Region | Required for homooligomerization | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 131_142 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 149_160 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 167_178 | 0 | 148.0 | Region | Interacts with SPRY1%2C SPRY2%2C SPRY3 and SPRY4 | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 2_94 | 0 | 148.0 | Region | Required for homooligomerization | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 126_178 | 10.0 | 179.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 126_178 | 0 | 148.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393467 | 0 | 2 | 2_104 | 0 | 148.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 126_178 | 0 | 148.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000393468 | 0 | 3 | 2_104 | 0 | 148.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 126_178 | 0 | 148.0 | Topological domain | Cytoplasmic | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000405348 | 0 | 3 | 2_104 | 0 | 148.0 | Topological domain | Cytoplasmic |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000358204 | + | 1 | 7 | 22_46 | 9.0 | 422.0 | Compositional bias | Note=Cys-rich |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000393481 | + | 1 | 7 | 22_46 | 0 | 413.0 | Compositional bias | Note=Cys-rich |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000358204 | + | 1 | 7 | 234_297 | 9.0 | 422.0 | Domain | LIM zinc-binding 1 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000358204 | + | 1 | 7 | 299_359 | 9.0 | 422.0 | Domain | LIM zinc-binding 2 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000358204 | + | 1 | 7 | 362_421 | 9.0 | 422.0 | Domain | LIM zinc-binding 3 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000358204 | + | 1 | 7 | 92_199 | 9.0 | 422.0 | Domain | PET |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000393481 | + | 1 | 7 | 234_297 | 0 | 413.0 | Domain | LIM zinc-binding 1 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000393481 | + | 1 | 7 | 299_359 | 0 | 413.0 | Domain | LIM zinc-binding 2 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000393481 | + | 1 | 7 | 362_421 | 0 | 413.0 | Domain | LIM zinc-binding 3 |
Hgene | TES | chr7:115850788 | chr7:116166579 | ENST00000393481 | + | 1 | 7 | 92_199 | 0 | 413.0 | Domain | PET |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 2_94 | 10.0 | 179.0 | Region | Required for homooligomerization | |
Tgene | CAV1 | chr7:115850788 | chr7:116166579 | ENST00000341049 | 0 | 3 | 2_104 | 10.0 | 179.0 | Topological domain | Cytoplasmic |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
TES | |
CAV1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to TES-CAV1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to TES-CAV1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |