| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:TGDS-DAPK1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: TGDS-DAPK1 | FusionPDB ID: 90422 | FusionGDB2.0 ID: 90422 | Hgene | Tgene | Gene symbol | TGDS | DAPK1 | Gene ID | 23483 | 1612 |
| Gene name | TDP-glucose 4,6-dehydratase | death associated protein kinase 1 | |
| Synonyms | CATMANS|SDR2E1|TDPGD | DAPK|ROCO3 | |
| Cytomap | 13q32.1 | 9q21.33 | |
| Type of gene | protein-coding | protein-coding | |
| Description | dTDP-D-glucose 4,6-dehydratasegrowth-inhibiting protein 21short chain dehydrogenase/reductase family 2E, member 1 | death-associated protein kinase 1DAP kinase 1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | . | P53355 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000261296, ENST00000498294, | ENST00000466188, ENST00000358077, ENST00000408954, ENST00000469640, ENST00000472284, ENST00000491893, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 1 X 1 X 1=1 | 9 X 8 X 6=432 |
| # samples | 1 | 9 | |
| ** MAII score | log2(1/1*10)=3.32192809488736 | log2(9/432*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: TGDS [Title/Abstract] AND DAPK1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TGDS(95248305)-DAPK1(90321047), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | TGDS-DAPK1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TGDS-DAPK1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TGDS-DAPK1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TGDS-DAPK1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | DAPK1 | GO:0006468 | protein phosphorylation | 10629061 |
| Tgene | DAPK1 | GO:0017148 | negative regulation of translation | 18995835 |
| Tgene | DAPK1 | GO:0035556 | intracellular signal transduction | 10629061 |
| Tgene | DAPK1 | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 16132846 |
| Tgene | DAPK1 | GO:0046777 | protein autophosphorylation | 10629061|12730201 |
| Tgene | DAPK1 | GO:0071346 | cellular response to interferon-gamma | 18995835 |
| Fusion gene breakpoints across TGDS (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DAPK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AO-A0J2-01A | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000472284 | DAPK1 | chr9 | 90321047 | + | 2706 | 207 | 114 | 1439 | 441 |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000469640 | DAPK1 | chr9 | 90321047 | + | 2709 | 207 | 114 | 1439 | 441 |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000491893 | DAPK1 | chr9 | 90321047 | + | 1458 | 207 | 114 | 1439 | 441 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.00058704 | 0.999413 |
| ENST00000261296 | ENST00000469640 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.000589688 | 0.9994103 |
| ENST00000261296 | ENST00000491893 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.00768891 | 0.9923111 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >90422_90422_1_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000469640_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- >90422_90422_2_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000472284_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- >90422_90422_3_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000491893_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:95248305/chr9:90321047) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | DAPK1 |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.; FUNCTION: Isoform 2 cannot induce apoptosis but can induce membrane blebbing. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 1312_1396 | 1020.0 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 1312_1396 | 1020.0 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 1312_1396 | 1020.0 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 1162_1196 | 1020.0 | 1431.0 | Repeat | Note=ANK 10 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 1162_1196 | 1020.0 | 1431.0 | Repeat | Note=ANK 10 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 1162_1196 | 1020.0 | 1431.0 | Repeat | Note=ANK 10 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 13_275 | 1020.0 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 681_955 | 1020.0 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 13_275 | 1020.0 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 681_955 | 1020.0 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 13_275 | 1020.0 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 681_955 | 1020.0 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 19_27 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 94_96 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 19_27 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 94_96 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 19_27 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 94_96 | 1020.0 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 267_334 | 1020.0 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 292_301 | 1020.0 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 267_334 | 1020.0 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 292_301 | 1020.0 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 267_334 | 1020.0 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 292_301 | 1020.0 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 378_407 | 1020.0 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 411_440 | 1020.0 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 444_473 | 1020.0 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 477_506 | 1020.0 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 510_539 | 1020.0 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 543_572 | 1020.0 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 576_605 | 1020.0 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 609_638 | 1020.0 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 875_904 | 1020.0 | 1431.0 | Repeat | Note=ANK 9 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 378_407 | 1020.0 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 411_440 | 1020.0 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 444_473 | 1020.0 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 477_506 | 1020.0 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 510_539 | 1020.0 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 543_572 | 1020.0 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 576_605 | 1020.0 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 609_638 | 1020.0 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 875_904 | 1020.0 | 1431.0 | Repeat | Note=ANK 9 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 378_407 | 1020.0 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 411_440 | 1020.0 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 444_473 | 1020.0 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 477_506 | 1020.0 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 510_539 | 1020.0 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 543_572 | 1020.0 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 576_605 | 1020.0 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 609_638 | 1020.0 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 875_904 | 1020.0 | 1431.0 | Repeat | Note=ANK 9 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| TGDS | |
| DAPK1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to TGDS-DAPK1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to TGDS-DAPK1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies