UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:THOP1-NOTCH3 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: THOP1-NOTCH3 | FusionPDB ID: 90689 | FusionGDB2.0 ID: 90689 | Hgene | Tgene | Gene symbol | THOP1 | NOTCH3 | Gene ID | 7064 | 4854 |
Gene name | thimet oligopeptidase 1 | notch receptor 3 | |
Synonyms | EP24.15|MEPD_HUMAN|MP78|TOP | CADASIL|CADASIL1|CASIL|IMF2|LMNS | |
Cytomap | 19p13.3 | 19p13.12 | |
Type of gene | protein-coding | protein-coding | |
Description | thimet oligopeptidaseendopeptidase 24.15 | neurogenic locus notch homolog protein 3Notch homolog 3notch 3 | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | . | Q9UM47 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000307741, ENST00000395212, ENST00000586677, ENST00000591149, | ENST00000263388, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 3=48 | 4 X 5 X 5=100 |
# samples | 4 | 6 | |
** MAII score | log2(4/48*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/100*10)=-0.736965594166206 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: THOP1 [Title/Abstract] AND NOTCH3 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | THOP1(2785676)-NOTCH3(15308389), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | THOP1-NOTCH3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. THOP1-NOTCH3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SARC | TCGA-FX-A3NK-01A | THOP1 | chr19 | 2785676 | - | NOTCH3 | chr19 | 15308389 | - |
ChimerDB4 | SARC | TCGA-FX-A3NK-01A | THOP1 | chr19 | 2785676 | + | NOTCH3 | chr19 | 15308389 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000307741 | THOP1 | chr19 | 2785676 | + | ENST00000263388 | NOTCH3 | chr19 | 15308389 | - | 8096 | 219 | 203 | 7066 | 2287 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000307741 | ENST00000263388 | THOP1 | chr19 | 2785676 | + | NOTCH3 | chr19 | 15308389 | - | 0.002880413 | 0.99711967 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >90689_90689_1_THOP1-NOTCH3_THOP1_chr19_2785676_ENST00000307741_NOTCH3_chr19_15308389_ENST00000263388_length(amino acids)=2287AA_BP=5 MKPPAAPPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCL SSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQ SGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVN GWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDE CSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVC KDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGY TGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECASS PCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGM GFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGP SCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCF NGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGAYCLC PPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGY NGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEA DINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCR ELQCPVGVPCQQTPRGPRCACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPEVSEE PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKY CADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPG SEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLL LVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEA VDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGALEPMPTEEDEADDTSASIISDLICQGAQLGAR TDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEE LIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQE RLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLSPVDS LDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQ LLNPGTPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:2785676/chr19:15308389) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | NOTCH3 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination (PubMed:15350543). Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs (By similarity). {ECO:0000250|UniProtKB:Q9R172, ECO:0000269|PubMed:15350543}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1000_1034 | 39.333333333333336 | 2322.0 | Domain | EGF-like 26 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1036_1082 | 39.333333333333336 | 2322.0 | Domain | EGF-like 27 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1084_1120 | 39.333333333333336 | 2322.0 | Domain | EGF-like 28 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1122_1158 | 39.333333333333336 | 2322.0 | Domain | EGF-like 29%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1160_1203 | 39.333333333333336 | 2322.0 | Domain | EGF-like 30%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 119_156 | 39.333333333333336 | 2322.0 | Domain | EGF-like 3 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1205_1244 | 39.333333333333336 | 2322.0 | Domain | EGF-like 31 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1246_1287 | 39.333333333333336 | 2322.0 | Domain | EGF-like 32 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1289_1325 | 39.333333333333336 | 2322.0 | Domain | EGF-like 33 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1335_1373 | 39.333333333333336 | 2322.0 | Domain | EGF-like 34 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 158_195 | 39.333333333333336 | 2322.0 | Domain | EGF-like 4%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 197_234 | 39.333333333333336 | 2322.0 | Domain | EGF-like 5 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 236_272 | 39.333333333333336 | 2322.0 | Domain | EGF-like 6%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 274_312 | 39.333333333333336 | 2322.0 | Domain | EGF-like 7 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 314_350 | 39.333333333333336 | 2322.0 | Domain | EGF-like 8%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 351_389 | 39.333333333333336 | 2322.0 | Domain | EGF-like 9 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 391_429 | 39.333333333333336 | 2322.0 | Domain | EGF-like 10%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 40_77 | 39.333333333333336 | 2322.0 | Domain | EGF-like 1 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 431_467 | 39.333333333333336 | 2322.0 | Domain | EGF-like 11%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 469_505 | 39.333333333333336 | 2322.0 | Domain | EGF-like 12%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 507_543 | 39.333333333333336 | 2322.0 | Domain | EGF-like 13%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 545_580 | 39.333333333333336 | 2322.0 | Domain | EGF-like 14%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 582_618 | 39.333333333333336 | 2322.0 | Domain | EGF-like 15%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 620_655 | 39.333333333333336 | 2322.0 | Domain | EGF-like 16%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 657_693 | 39.333333333333336 | 2322.0 | Domain | EGF-like 17%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 695_730 | 39.333333333333336 | 2322.0 | Domain | EGF-like 18 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 734_770 | 39.333333333333336 | 2322.0 | Domain | EGF-like 19 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 771_808 | 39.333333333333336 | 2322.0 | Domain | EGF-like 20 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 78_118 | 39.333333333333336 | 2322.0 | Domain | EGF-like 2 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 810_847 | 39.333333333333336 | 2322.0 | Domain | EGF-like 21%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 849_885 | 39.333333333333336 | 2322.0 | Domain | EGF-like 22%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 887_922 | 39.333333333333336 | 2322.0 | Domain | EGF-like 23%3B calcium-binding | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 924_960 | 39.333333333333336 | 2322.0 | Domain | EGF-like 24 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 962_998 | 39.333333333333336 | 2322.0 | Domain | EGF-like 25 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1387_1427 | 39.333333333333336 | 2322.0 | Repeat | Note=LNR 1 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1428_1458 | 39.333333333333336 | 2322.0 | Repeat | Note=LNR 2 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1467_1505 | 39.333333333333336 | 2322.0 | Repeat | Note=LNR 3 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1838_1867 | 39.333333333333336 | 2322.0 | Repeat | Note=ANK 1 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1871_1901 | 39.333333333333336 | 2322.0 | Repeat | Note=ANK 2 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1905_1934 | 39.333333333333336 | 2322.0 | Repeat | Note=ANK 3 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1938_1967 | 39.333333333333336 | 2322.0 | Repeat | Note=ANK 4 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1971_2000 | 39.333333333333336 | 2322.0 | Repeat | Note=ANK 5 | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1665_2321 | 39.333333333333336 | 2322.0 | Topological domain | Cytoplasmic | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 40_1643 | 39.333333333333336 | 2322.0 | Topological domain | Extracellular | |
Tgene | NOTCH3 | chr19:2785676 | chr19:15308389 | ENST00000263388 | 0 | 33 | 1644_1664 | 39.333333333333336 | 2322.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
THOP1 | |
NOTCH3 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to THOP1-NOTCH3 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to THOP1-NOTCH3 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |