UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:VRK3-CBLC |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: VRK3-CBLC | FusionPDB ID: 98543 | FusionGDB2.0 ID: 98543 | Hgene | Tgene | Gene symbol | VRK3 | CBLC | Gene ID | 51231 | 23624 |
Gene name | VRK serine/threonine kinase 3 | Cbl proto-oncogene C | |
Synonyms | - | CBL-3|CBL-SL|RNF57 | |
Cytomap | 19q13.33 | 19q13.32 | |
Type of gene | protein-coding | protein-coding | |
Description | inactive serine/threonine-protein kinase VRK3serine/threonine-protein kinase VRK3serine/threonine-protein pseudokinase VRK3vaccinia related kinase 3 | E3 ubiquitin-protein ligase CBL-CCas-Br-M (murine) ecotropic retroviral transforming sequence cCas-Br-M (murine) ectropic retroviral transforming sequence cCbl proto-oncogene C, E3 ubiquitin protein ligaseCbl proto-oncogene, E3 ubiquitin protein ligas | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | Q9ULV8 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000424804, ENST00000443401, ENST00000593919, ENST00000594092, ENST00000594948, ENST00000599538, ENST00000601341, ENST00000601912, ENST00000316763, ENST00000377011, | ENST00000270279, ENST00000341505, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 6 X 4=168 | 4 X 7 X 2=56 |
# samples | 9 | 7 | |
** MAII score | log2(9/168*10)=-0.900464326449086 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/56*10)=0.321928094887362 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: VRK3 [Title/Abstract] AND CBLC [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | VRK3(50504046)-CBLC(45296730), # samples:1 VRK3(50504047)-CBLC(45296731), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. VRK3-CBLC seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. VRK3-CBLC seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CBLC | GO:0006511 | ubiquitin-dependent protein catabolic process | 14661060 |
Tgene | CBLC | GO:0007175 | negative regulation of epidermal growth factor-activated receptor activity | 10362357 |
Tgene | CBLC | GO:0016567 | protein ubiquitination | 14661060 |
Tgene | CBLC | GO:0042059 | negative regulation of epidermal growth factor receptor signaling pathway | 10362357 |
Tgene | CBLC | GO:0043407 | negative regulation of MAP kinase activity | 10362357 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-B5-A1N2-01A | VRK3 | chr19 | 50504047 | - | CBLC | chr19 | 45296731 | + |
ChimerDB4 | UCEC | TCGA-B5-A1N2 | VRK3 | chr19 | 50504046 | - | CBLC | chr19 | 45296730 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000316763 | VRK3 | chr19 | 50504046 | - | ENST00000341505 | CBLC | chr19 | 45296730 | + | 1175 | 796 | 184 | 1083 | 299 |
ENST00000316763 | VRK3 | chr19 | 50504046 | - | ENST00000270279 | CBLC | chr19 | 45296730 | + | 1175 | 796 | 184 | 1083 | 299 |
ENST00000377011 | VRK3 | chr19 | 50504046 | - | ENST00000341505 | CBLC | chr19 | 45296730 | + | 1011 | 632 | 170 | 919 | 249 |
ENST00000377011 | VRK3 | chr19 | 50504046 | - | ENST00000270279 | CBLC | chr19 | 45296730 | + | 1011 | 632 | 170 | 919 | 249 |
ENST00000316763 | VRK3 | chr19 | 50504047 | - | ENST00000341505 | CBLC | chr19 | 45296731 | + | 1175 | 796 | 184 | 1083 | 299 |
ENST00000316763 | VRK3 | chr19 | 50504047 | - | ENST00000270279 | CBLC | chr19 | 45296731 | + | 1175 | 796 | 184 | 1083 | 299 |
ENST00000377011 | VRK3 | chr19 | 50504047 | - | ENST00000341505 | CBLC | chr19 | 45296731 | + | 1011 | 632 | 170 | 919 | 249 |
ENST00000377011 | VRK3 | chr19 | 50504047 | - | ENST00000270279 | CBLC | chr19 | 45296731 | + | 1011 | 632 | 170 | 919 | 249 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000316763 | ENST00000341505 | VRK3 | chr19 | 50504046 | - | CBLC | chr19 | 45296730 | + | 0.15018769 | 0.8498123 |
ENST00000316763 | ENST00000270279 | VRK3 | chr19 | 50504046 | - | CBLC | chr19 | 45296730 | + | 0.15018769 | 0.8498123 |
ENST00000377011 | ENST00000341505 | VRK3 | chr19 | 50504046 | - | CBLC | chr19 | 45296730 | + | 0.18593545 | 0.81406456 |
ENST00000377011 | ENST00000270279 | VRK3 | chr19 | 50504046 | - | CBLC | chr19 | 45296730 | + | 0.18593545 | 0.81406456 |
ENST00000316763 | ENST00000341505 | VRK3 | chr19 | 50504047 | - | CBLC | chr19 | 45296731 | + | 0.15018769 | 0.8498123 |
ENST00000316763 | ENST00000270279 | VRK3 | chr19 | 50504047 | - | CBLC | chr19 | 45296731 | + | 0.15018769 | 0.8498123 |
ENST00000377011 | ENST00000341505 | VRK3 | chr19 | 50504047 | - | CBLC | chr19 | 45296731 | + | 0.18593545 | 0.81406456 |
ENST00000377011 | ENST00000270279 | VRK3 | chr19 | 50504047 | - | CBLC | chr19 | 45296731 | + | 0.18593545 | 0.81406456 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >98543_98543_1_VRK3-CBLC_VRK3_chr19_50504046_ENST00000316763_CBLC_chr19_45296730_ENST00000270279_length(amino acids)=299AA_BP=204 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL YEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPR -------------------------------------------------------------- >98543_98543_2_VRK3-CBLC_VRK3_chr19_50504046_ENST00000316763_CBLC_chr19_45296730_ENST00000341505_length(amino acids)=299AA_BP=204 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL YEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPR -------------------------------------------------------------- >98543_98543_3_VRK3-CBLC_VRK3_chr19_50504046_ENST00000377011_CBLC_chr19_45296730_ENST00000270279_length(amino acids)=249AA_BP=154 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFH -------------------------------------------------------------- >98543_98543_4_VRK3-CBLC_VRK3_chr19_50504046_ENST00000377011_CBLC_chr19_45296730_ENST00000341505_length(amino acids)=249AA_BP=154 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFH -------------------------------------------------------------- >98543_98543_5_VRK3-CBLC_VRK3_chr19_50504047_ENST00000316763_CBLC_chr19_45296731_ENST00000270279_length(amino acids)=299AA_BP=204 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL YEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPR -------------------------------------------------------------- >98543_98543_6_VRK3-CBLC_VRK3_chr19_50504047_ENST00000316763_CBLC_chr19_45296731_ENST00000341505_length(amino acids)=299AA_BP=204 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL YEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPR -------------------------------------------------------------- >98543_98543_7_VRK3-CBLC_VRK3_chr19_50504047_ENST00000377011_CBLC_chr19_45296731_ENST00000270279_length(amino acids)=249AA_BP=154 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFH -------------------------------------------------------------- >98543_98543_8_VRK3-CBLC_VRK3_chr19_50504047_ENST00000377011_CBLC_chr19_45296731_ENST00000341505_length(amino acids)=249AA_BP=154 MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLHSDSQTCPFCRCEIKGWEAVSIYQFH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:50504046/chr19:45296730) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | CBLC |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Acts as an E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Functionally coupled with the E2 ubiquitin-protein ligases UB2D1, UB2D2 and UB2D3. Regulator of EGFR mediated signal transduction; upon EGF activation, ubiquitinates EGFR. Isoform 1, but not isoform 2, inhibits EGF stimulated MAPK1 activation. Promotes ubiquitination of SRC phosphorylated at 'Tyr-419'. In collaboration with CD2AP may act as regulatory checkpoint for Ret signaling by modulating the rate of RET degradation after ligand activation; CD2AP converts it from an inhibitor to a promoter of RET degradation; the function limits the potency of GDNF on neuronal survival. {ECO:0000269|PubMed:10362357, ECO:0000269|PubMed:14661060, ECO:0000269|PubMed:18753381, ECO:0000269|PubMed:20525694, ECO:0000269|PubMed:23145173}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000316763 | - | 6 | 15 | 49_64 | 204.0 | 573.3333333333334 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000377011 | - | 5 | 14 | 49_64 | 154.0 | 519.6666666666666 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000594092 | - | 6 | 13 | 49_64 | 204.0 | 413.0 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000594948 | - | 6 | 14 | 49_64 | 204.0 | 475.0 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000599538 | - | 6 | 15 | 49_64 | 204.0 | 315.3333333333333 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000601341 | - | 5 | 13 | 49_64 | 154.0 | 425.0 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000316763 | - | 6 | 15 | 49_64 | 204.0 | 573.3333333333334 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000377011 | - | 5 | 14 | 49_64 | 154.0 | 519.6666666666666 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000594092 | - | 6 | 13 | 49_64 | 204.0 | 413.0 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000594948 | - | 6 | 14 | 49_64 | 204.0 | 475.0 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000599538 | - | 6 | 15 | 49_64 | 204.0 | 315.3333333333333 | Motif | Nuclear localization signal |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000601341 | - | 5 | 13 | 49_64 | 154.0 | 425.0 | Motif | Nuclear localization signal |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 351_390 | 333.0 | 318.3333333333333 | Zinc finger | RING-type | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 351_390 | 333.0 | 318.3333333333333 | Zinc finger | RING-type |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000316763 | - | 6 | 15 | 166_457 | 204.0 | 573.3333333333334 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000377011 | - | 5 | 14 | 166_457 | 154.0 | 519.6666666666666 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000594092 | - | 6 | 13 | 166_457 | 204.0 | 413.0 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000594948 | - | 6 | 14 | 166_457 | 204.0 | 475.0 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000599538 | - | 6 | 15 | 166_457 | 204.0 | 315.3333333333333 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504046 | chr19:45296730 | ENST00000601341 | - | 5 | 13 | 166_457 | 154.0 | 425.0 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000316763 | - | 6 | 15 | 166_457 | 204.0 | 573.3333333333334 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000377011 | - | 5 | 14 | 166_457 | 154.0 | 519.6666666666666 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000594092 | - | 6 | 13 | 166_457 | 204.0 | 413.0 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000594948 | - | 6 | 14 | 166_457 | 204.0 | 475.0 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000599538 | - | 6 | 15 | 166_457 | 204.0 | 315.3333333333333 | Domain | Protein kinase |
Hgene | VRK3 | chr19:50504047 | chr19:45296731 | ENST00000601341 | - | 5 | 13 | 166_457 | 154.0 | 425.0 | Domain | Protein kinase |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 199_210 | 379.0 | 364.3333333333333 | Calcium binding | . | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 199_210 | 333.0 | 318.3333333333333 | Calcium binding | . | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 199_210 | 379.0 | 364.3333333333333 | Calcium binding | . | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 199_210 | 333.0 | 318.3333333333333 | Calcium binding | . | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 7_321 | 379.0 | 364.3333333333333 | Domain | Cbl-PTB | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 7_321 | 333.0 | 318.3333333333333 | Domain | Cbl-PTB | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 7_321 | 379.0 | 364.3333333333333 | Domain | Cbl-PTB | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 7_321 | 333.0 | 318.3333333333333 | Domain | Cbl-PTB | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 146_218 | 379.0 | 364.3333333333333 | Region | Note=EF-hand-like | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 219_321 | 379.0 | 364.3333333333333 | Region | Note=SH2-like | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 322_350 | 379.0 | 364.3333333333333 | Region | Note=Linker | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 7_145 | 379.0 | 364.3333333333333 | Region | Note=4H | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 146_218 | 333.0 | 318.3333333333333 | Region | Note=EF-hand-like | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 219_321 | 333.0 | 318.3333333333333 | Region | Note=SH2-like | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 322_350 | 333.0 | 318.3333333333333 | Region | Note=Linker | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000341505 | 5 | 10 | 7_145 | 333.0 | 318.3333333333333 | Region | Note=4H | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 146_218 | 379.0 | 364.3333333333333 | Region | Note=EF-hand-like | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 219_321 | 379.0 | 364.3333333333333 | Region | Note=SH2-like | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 322_350 | 379.0 | 364.3333333333333 | Region | Note=Linker | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 7_145 | 379.0 | 364.3333333333333 | Region | Note=4H | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 146_218 | 333.0 | 318.3333333333333 | Region | Note=EF-hand-like | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 219_321 | 333.0 | 318.3333333333333 | Region | Note=SH2-like | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 322_350 | 333.0 | 318.3333333333333 | Region | Note=Linker | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000341505 | 5 | 10 | 7_145 | 333.0 | 318.3333333333333 | Region | Note=4H | |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 351_390 | 379.0 | 364.3333333333333 | Zinc finger | RING-type | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 351_390 | 379.0 | 364.3333333333333 | Zinc finger | RING-type |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
VRK3 | |
CBLC |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | CBLC | chr19:50504046 | chr19:45296730 | ENST00000270279 | 6 | 11 | 351_474 | 379.0 | 364.3333333333333 | RET | |
Tgene | CBLC | chr19:50504047 | chr19:45296731 | ENST00000270279 | 6 | 11 | 351_474 | 379.0 | 364.3333333333333 | RET |
Top |
Related Drugs to VRK3-CBLC |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to VRK3-CBLC |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |