UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:BMPR2-CYP20A1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: BMPR2-CYP20A1 | FusionPDB ID: 9925 | FusionGDB2.0 ID: 9925 | Hgene | Tgene | Gene symbol | BMPR2 | CYP20A1 | Gene ID | 659 | 57404 |
Gene name | bone morphogenetic protein receptor type 2 | cytochrome P450 family 20 subfamily A member 1 | |
Synonyms | BMPR-II|BMPR3|BMR2|BRK-3|POVD1|PPH1|T-ALK | CYP-M | |
Cytomap | 2q33.1-q33.2 | 2q33.2 | |
Type of gene | protein-coding | protein-coding | |
Description | bone morphogenetic protein receptor type-2BMP type II receptorBMP type-2 receptorbone morphogenetic protein receptor type IIbone morphogenetic protein receptor, type II (serine/threonine kinase)type II activin receptor-like kinasetype II receptor fo | cytochrome P450 20A1cytochrome P450 monooxygenasecytochrome P450, family 20, subfamily A, polypeptide 1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q13873 | Q6UW02 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000479069, ENST00000374574, ENST00000374580, | ENST00000356079, ENST00000429815, ENST00000461371, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 20 X 12 X 9=2160 | 8 X 11 X 5=440 |
# samples | 21 | 9 | |
** MAII score | log2(21/2160*10)=-3.36257007938471 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/440*10)=-2.28950661719499 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: BMPR2 [Title/Abstract] AND CYP20A1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | BMPR2(203332412)-CYP20A1(204116690), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BMPR2-CYP20A1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BMPR2-CYP20A1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | BMPR2 | GO:0007178 | transmembrane receptor protein serine/threonine kinase signaling pathway | 12045205 |
Hgene | BMPR2 | GO:0010634 | positive regulation of epithelial cell migration | 12819188 |
Hgene | BMPR2 | GO:0030308 | negative regulation of cell growth | 12819188 |
Hgene | BMPR2 | GO:0030509 | BMP signaling pathway | 18436533 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-E2-A573-01A | BMPR2 | chr2 | 203332412 | + | CYP20A1 | chr2 | 204116690 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000374580 | BMPR2 | chr2 | 203332412 | + | ENST00000356079 | CYP20A1 | chr2 | 204116690 | + | 2494 | 957 | 524 | 2056 | 510 |
ENST00000374574 | BMPR2 | chr2 | 203332412 | + | ENST00000356079 | CYP20A1 | chr2 | 204116690 | + | 1996 | 459 | 26 | 1558 | 510 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000374580 | ENST00000356079 | BMPR2 | chr2 | 203332412 | + | CYP20A1 | chr2 | 204116690 | + | 0.001302225 | 0.99869776 |
ENST00000374574 | ENST00000356079 | BMPR2 | chr2 | 203332412 | + | CYP20A1 | chr2 | 204116690 | + | 0.000653316 | 0.9993467 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >9925_9925_1_BMPR2-CYP20A1_BMPR2_chr2_203332412_ENST00000374574_CYP20A1_chr2_204116690_ENST00000356079_length(amino acids)=510AA_BP=145 MAGPGMTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCW SHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLTDPFETMLKSLLRYQSGGGSVSENHMRKKLYENGVT DSLKSNFALLLKLSEELLDKWLSYPETQHVPLSQHMLGFAMKSVTQMVMGSTFEDDQEVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKK QYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILEDSMIFSLASCIITAKLCTWAICFLTTSEEVQKKLYEEINQVFGN GPVTPEKIEQLRYCQHVLCETVRTAKLTPVSAQLQDIEGKIDRFIIPRETLVLYALGVVLQDPNTWPSPHKFDPDRFDDELVMKTFSSLG -------------------------------------------------------------- >9925_9925_2_BMPR2-CYP20A1_BMPR2_chr2_203332412_ENST00000374580_CYP20A1_chr2_204116690_ENST00000356079_length(amino acids)=510AA_BP=145 MAGPGMTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCW SHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLTDPFETMLKSLLRYQSGGGSVSENHMRKKLYENGVT DSLKSNFALLLKLSEELLDKWLSYPETQHVPLSQHMLGFAMKSVTQMVMGSTFEDDQEVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKK QYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILEDSMIFSLASCIITAKLCTWAICFLTTSEEVQKKLYEEINQVFGN GPVTPEKIEQLRYCQHVLCETVRTAKLTPVSAQLQDIEGKIDRFIIPRETLVLYALGVVLQDPNTWPSPHKFDPDRFDDELVMKTFSSLG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:203332412/chr2:204116690) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
BMPR2 | CYP20A1 |
FUNCTION: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Binds to BMP7, BMP2 and, less efficiently, BMP4. Binding is weak but enhanced by the presence of type I receptors for BMPs. Mediates induction of adipogenesis by GDF6. {ECO:0000250|UniProtKB:O35607}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 547_550 | 139.33333333333334 | 1039.0 | Compositional bias | Note=Poly-Ser |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 610_618 | 139.33333333333334 | 1039.0 | Compositional bias | Note=Poly-Thr |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 901_908 | 139.33333333333334 | 1039.0 | Compositional bias | Note=Poly-Asn |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 203_504 | 139.33333333333334 | 1039.0 | Domain | Protein kinase |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 209_217 | 139.33333333333334 | 1039.0 | Nucleotide binding | ATP |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 280_282 | 139.33333333333334 | 1039.0 | Nucleotide binding | ATP |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 337_338 | 139.33333333333334 | 1039.0 | Nucleotide binding | ATP |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 172_1038 | 139.33333333333334 | 1039.0 | Topological domain | Cytoplasmic |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 27_150 | 139.33333333333334 | 1039.0 | Topological domain | Extracellular |
Hgene | BMPR2 | chr2:203332412 | chr2:204116690 | ENST00000374580 | + | 3 | 13 | 151_171 | 139.33333333333334 | 1039.0 | Transmembrane | Helical |
Tgene | CYP20A1 | chr2:203332412 | chr2:204116690 | ENST00000356079 | 2 | 13 | 4_24 | 96.33333333333333 | 463.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
BMPR2 | |
CYP20A1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to BMPR2-CYP20A1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to BMPR2-CYP20A1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |