|
Translation Factor: EIF2B1 (NCBI Gene ID:1967) |
|
Gene Summary |
Gene Information | Gene Name: EIF2B1 | Gene ID: 1967 | Gene Symbol | EIF2B1 | Gene ID | 1967 |
Gene Name | eukaryotic translation initiation factor 2B subunit alpha | |
Synonyms | EIF2B|EIF2BA | |
Cytomap | 12q24.31 | |
Type of Gene | protein-coding | |
Description | translation initiation factor eIF-2B subunit alphaeIF-2B GDP-GTP exchange factor subunit alphaeukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa | |
Modification date | 20200327 | |
UniProtAcc | Q14232 |
Child GO biological process term(s) under GO:0006412 |
GO ID | GO term |
GO:0006417 | Regulation of translation |
GO:0008135 | Translation factor activity, RNA binding |
GO:0006413 | Translational initiation |
GO:0006412 | Translation |
Gene ontology of translaction factor with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | EIF2B1 | GO:0006413 | translational initiation | 16289705 |
Hgene | EIF2B1 | GO:0050852 | T cell receptor signaling pathway | 8626696 |
Inferred gene age of translation factor. |
Gene | Inferred gene age group among (0 - 67.6], (67.6 - 355.7], (355.7 - 733], (733 - 1119.25], >1119.25 |
EIF2B1 | >1119.25 |
Top |
|
We searched PubMed using 'EIF2B1[title] AND translation [title] AND human.' |
Gene | Title | PMID |
EIF2B1 | . | . |
Top |
|
Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. For more annotations, please visit our ExonSkipDB. |
Open reading frame (ORF) analsis of exon skipping events based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ENST | Exon skip start (DNA) | Exon Skip end (DNA) | ORF |
ENST00000424014 | 124109333 | 124109409 | Frame-shift |
ENST00000424014 | 124110971 | 124111040 | In-frame |
Exon skipping position in the amino acid sequence. |
ENST | Exon skip start (DNA) | Exon Skip end (DNA) | Len(transcript seq) | Exon skip start (mRNA) | Exon Skip end (mRNA) | Len(amino acid seq) | Exon skip start (AA) | Exon Skip end (AA) |
ENST00000424014 | 124110971 | 124111040 | 2494 | 692 | 760 | 305 | 161 | 183 |
Potentially (partially) lost protein functional features of UniProt. |
UniProtAcc | Exon skip start (AA) | Exon Skip end (AA) | Function feature start (AA) | Function feature end (AA) | Functional feature type | Functional feature desc. |
Q14232 | 161 | 183 | 1 | 305 | Chain | ID=PRO_0000156055;Note=Translation initiation factor eIF-2B subunit alpha |
Q14232 | 161 | 183 | 162 | 222 | Alternative sequence | ID=VSP_055469;Note=In isoform 2. KKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQ->QVPFCSVMCPAIILQSKLRITVQQDQNQNVPPACQQSALPFIVPFPAFGRKITEFAAGRSI;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q14232 | 161 | 183 | 183 | 183 | Natural variant | ID=VAR_068450;Note=In VWM. V->F;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15776425;Dbxref=dbSNP:rs863225048,PMID:15776425 |
Q14232 | 161 | 183 | 160 | 169 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3ECS |
Q14232 | 161 | 183 | 170 | 172 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3ECS |
Q14232 | 161 | 183 | 175 | 178 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3ECS |
Q14232 | 161 | 183 | 180 | 182 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3ECS |
Q14232 | 161 | 183 | 183 | 186 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3ECS |
Top |
|
Gene expression level across TCGA pancancer |
Gene expression level across GTEx pantissue |
Expression level of gene isoforms across TCGA pancancer |
Expression level of gene isoforms across GTEx pantissue |
Cancer(tissue) type-specific expression level of Translation factor using z-score distriution |
Differential expression between tumor and matched normal (in the cancer types with more than 10 matched samples) |
Cancer type | Translation factor | FC | adj.pval |
STAD | EIF2B1 | 1.06970835543362 | 0.0324882394634187 |
KIRP | EIF2B1 | -2.14953108463177 | 5.24520874023438e-06 |
LUAD | EIF2B1 | -2.39668434561352 | 5.70558004016916e-06 |
KIRC | EIF2B1 | -1.83635928054145 | 7.43306349049898e-12 |
Top |
|
Translation factor expression regulation through miRNA binding |
Cancer type | Gene | miRNA | TargetScan binding score (Context++ score percentile) | Coefficient | Pvalue |
Translation factor expression regulation through methylation in the promoter of Translation factor |
Cancer type | Gene | methyl group b | methyl group a | DEG pval | avg methyl in b | avg methyl in a | avg exp in b | avg exp in a |
Translation factor expression regulation through methylation in the gene body of Translation factor (positive regulation) |
Cancer type | Gene | methyl group b | methyl group a | DEG pval | avg methyl in b | avg methyl in a | avg exp in b | avg exp in a |
Translation factor expression regulation through copy number variation of Translation factor |
Cancer type | Gene | Coefficient | Pvalue |
GBM | EIF2B1 | 0.407059022 | 0.006758086 |
SARC | EIF2B1 | 0.435463008 | 0.01961936 |
Top |
|
Strongly correlated genes belong to cellular important gene groups with EIF2B1 (coefficient>0.8, pval<0.05, node color based on FC between tumor and matched normal). Significantly associated important genes in the individual cancer types. * Cell metabolism gene: cell metabolism genes from REACTOME (black edge), IUPHAR: drug target genes from IUPHAR (blue edge), Kinase: human kinase genes (brown edge), CGC: cancer gene census genes (orange edge), TSG: tumor suppresor genes (purple edge), Epifactor: epigenetic factors (light blue edge), TF: transcription factors (green) |
Cancer type | Gene group | Translation factor | Correlated gene | Coefficient | Pvalue |
UVM | Cell metabolism gene | EIF2B1 | NUP107 | 0.829335112 | 2.07E-21 |
Top |
|
Protein 3D structure Visit iCn3D. |
Top |
|
Protein-protein interaction networks * Overlap between up-regulated DEGs (log2FC<-1 and adj.P<0.05) and STRING PPI network (center: Translation factor, node: DEGs, edges: weighted by -log2(adj.P)) |
Overlap between down-regulated DEGs (log2FC>1 and adj.P<0.05) and STRING PPI network (center: Translation factor, node: DEGs, edges: weighted by -log2(adj.P)) |
* Edge colors based on TCGA cancer types. |
* Overlap between DEGs (log2FC>1 and adj.P<0.05) and STRING PPI network per cancer (center: Translation factor, node: DEGs, node color: log2FC, edges: weighted by -log2(adj.P)) |
Cancer type | Translation factor | Interacting protein coding gene | FC | adj.pval |
KIRP | EIF2B1 | PSMA1 | -1.12149722834627 | 0.000110303983092308 |
LIHC | EIF2B1 | EIF2B5 | -2.17335102876885 | 0.000112780019881286 |
KICH | EIF2B1 | EIF2B3 | 2.17795043401278 | 0.000216901302337646 |
THCA | EIF2B1 | EIF2B3 | -2.27193247701228 | 0.000372452864704637 |
LIHC | EIF2B1 | EIF2S3 | -4.62530933210412 | 0.00154404530385922 |
LIHC | EIF2B1 | EIF2AK4 | -4.60322890059861 | 0.00188131470650586 |
LUSC | EIF2B1 | EIF2AK4 | 1.88005113022765 | 0.00283162168555847 |
KICH | EIF2B1 | EIF2S2 | -1.06278646532411 | 0.00308787822723389 |
HNSC | EIF2B1 | EIF2B3 | -1.66956934127194 | 0.00459462782941955 |
COAD | EIF2B1 | EIF2B3 | -1.60183733464354 | 0.00938254594802858 |
COAD | EIF2B1 | EIF2B5 | -3.82949281161428 | 0.011966735124588 |
COAD | EIF2B1 | EIF2B4 | -1.63825654493327 | 0.0204286277294159 |
CHOL | EIF2B1 | EIF2B2 | -1.61211785827489 | 0.02734375 |
ESCA | EIF2B1 | EIF2S3 | -1.31322237574718 | 0.0419921875 |
BRCA | EIF2B1 | EIF2S2 | -2.57303037687825 | 1.70212120584918e-09 |
LUSC | EIF2B1 | EIF2B4 | -4.42561330574195 | 1.73490174268501e-07 |
PRAD | EIF2B1 | EIF2B4 | 1.20626610203239 | 1.94411875335162e-07 |
KIRC | EIF2B1 | PSMA1 | -4.17168119560721 | 2.03930517801747e-11 |
LUAD | EIF2B1 | EIF2B4 | -1.76566297999877 | 3.09848396407815e-08 |
STAD | EIF2B1 | EIF2S2 | -2.13186277769467 | 3.17529775202275e-05 |
LIHC | EIF2B1 | EIF2B2 | -1.75683032348821 | 4.08414278982391e-05 |
LUAD | EIF2B1 | EIF2B2 | -3.96081365689084 | 4.19177862905507e-09 |
BRCA | EIF2B1 | EIF2B3 | -1.42398409637427 | 6.27134207487183e-10 |
KICH | EIF2B1 | PSMA1 | -1.95225949436722 | 7.49826431274414e-05 |
KICH | EIF2B1 | EIF2B4 | 1.3794276859253 | 8.16583633422851e-06 |
Protein-protein interactors with this translation factor (BIOGRID-3.4.160) |
PPI interactors with EIF2B1 |
EIF2B3, PDIA4, ARHGDIA, EIF2B5, DCD, HNRNPL, MRPL4, ARL4D, EIF2S1, ADRB2, ADRA2B, ADRA2C, DCC, STK11, GCD2, EIF2B2, GCD6, EIF2B1, GORASP2, WDYHV1, RD3, EGFR, BZW2, VTI1B, STX12, FOXR2, CA14, GPR183, LUC7L, P2RX4, PTGER3, PVRL4, HNRNPA1, AP2A1, AP2A2, ARF1, CAD, EIF2B4, LYPLA2, MTAP, SERPINB3, TRMT6, MPST, SERPINB13, NTRK1, XPO1, HNRNPU, RPL10, SORT1, SYNCRIP, NOP56, SGTB, ZFC3H1, Mcm3, Rpl35, Rrbp1, EPM2A, GYPB, SIGLECL1, CLEC3A, BHLHA15, SMDT1, MCU, DLD, ESR2, MEPCE, RECQL4, KIAA1429, ATG16L1, TNFSF13B, UNC93B1, BIRC3, MED29, UBE2I, C1orf50, ATF5, TRIML2, TRIM59, PLEKHA4, MYH9, RBM47, nsp9ab, LRRC59, BRD4, COPS5, nsp9, YWHAE, IFI16, DDRGK1, ZNF385C, CLEC2B, PRM2, BTC, SYT2, BTNL9, EFNB1, RPL37, TACSTD2, C3orf18, CD226, CHCHD2, SEC62, DDX50, COMTD1, SPN, DDX54, TMEM55A, PTAFR, CD40, EXOG, |
Top |
|
Clinically associated variants from ClinVar. |
Gene | Chr | Position | RefSeq | VarSeq | RefSeeq | VarType | Pathogenic | Disease | VarInfo |
EIF2B1 | chr12 | 124105572 | A | G | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105638 | G | A | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105663 | A | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105774 | C | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105795 | T | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105797 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105839 | T | C | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105877 | C | G | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105878 | C | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105881 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105908 | A | G | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105925 | G | A | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105948 | C | T | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105949 | G | T | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105951 | G | C | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124105971 | T | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106045 | T | C | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106084 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106107 | T | A | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106124 | T | G | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106154 | G | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106254 | C | T | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter|not_specified | SO:0001624|3_prime_UTR_variant | SO:0001624|3_prime_UTR_variant |
EIF2B1 | chr12 | 124106330 | G | A | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124106353 | C | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124106388 | G | C | single_nucleotide_variant | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124106397 | T | C | single_nucleotide_variant | Likely_pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124106408 | C | T | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124106441 | C | T | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124107176 | C | T | single_nucleotide_variant | Likely_benign | not_provided | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124107201 | G | A | single_nucleotide_variant | Uncertain_significance | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124107221 | A | C | single_nucleotide_variant | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124107265 | T | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124107274 | G | A | single_nucleotide_variant | Uncertain_significance | not_provided | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124109334 | C | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124109339 | T | A | single_nucleotide_variant | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124109340 | A | T | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124109345 | TTCC | T | Microsatellite | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001822|inframe_deletion | SO:0001822|inframe_deletion |
EIF2B1 | chr12 | 124109346 | T | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124109352 | G | A | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124109371 | GCA | G | Deletion | Likely_pathogenic | not_provided | SO:0001589|frameshift_variant | SO:0001589|frameshift_variant |
EIF2B1 | chr12 | 124110934 | G | T | single_nucleotide_variant | Benign | not_specified | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124110972 | C | T | single_nucleotide_variant | Uncertain_significance | Seizures | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124110976 | C | A | single_nucleotide_variant | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124110980 | A | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124110999 | A | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124111062 | C | A | single_nucleotide_variant | Benign | not_specified | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124111588 | T | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124111605 | C | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124111634 | G | A | single_nucleotide_variant | Conflicting_interpretations_of_pathogenicity | Leukoencephalopathy_with_vanishing_white_matter|not_provided | SO:0001587|nonsense | SO:0001587|nonsense |
EIF2B1 | chr12 | 124111643 | C | T | single_nucleotide_variant | Uncertain_significance | not_provided | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124111644 | C | T | single_nucleotide_variant | Conflicting_interpretations_of_pathogenicity | Leukoencephalopathy_with_vanishing_white_matter|not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124111656 | T | C | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter|not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124111684 | T | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124111697 | A | G | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124111713 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124111723 | T | C | single_nucleotide_variant | Benign | not_specified|not_provided | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124114666 | G | A | single_nucleotide_variant | Likely_benign | not_specified | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124114757 | T | C | single_nucleotide_variant | Pathogenic | Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124114931 | A | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124114943 | C | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter|not_provided | SO:0001575|splice_donor_variant | SO:0001575|splice_donor_variant |
EIF2B1 | chr12 | 124114944 | G | A | single_nucleotide_variant | Uncertain_significance | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124115020 | A | G | single_nucleotide_variant | Benign/Likely_benign | Leukoencephalopathy_with_vanishing_white_matter|not_provided | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124115046 | G | C | single_nucleotide_variant | Likely_benign | not_provided | SO:0001819|synonymous_variant | SO:0001819|synonymous_variant |
EIF2B1 | chr12 | 124117006 | A | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001627|intron_variant | SO:0001627|intron_variant |
EIF2B1 | chr12 | 124118098 | C | A | single_nucleotide_variant | Uncertain_significance | Microcephaly|Leukoencephalopathy_with_vanishing_white_matter | SO:0001583|missense_variant | SO:0001583|missense_variant |
EIF2B1 | chr12 | 124118174 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001623|5_prime_UTR_variant | SO:0001623|5_prime_UTR_variant |
EIF2B1 | chr12 | 124118189 | C | T | single_nucleotide_variant | Likely_benign | Leukoencephalopathy_with_vanishing_white_matter | SO:0001623|5_prime_UTR_variant | SO:0001623|5_prime_UTR_variant |
EIF2B1 | chr12 | 124118195 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001623|5_prime_UTR_variant | SO:0001623|5_prime_UTR_variant |
EIF2B1 | chr12 | 124118195 | G | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | SO:0001623|5_prime_UTR_variant | SO:0001623|5_prime_UTR_variant |
EIF2B1 | chr12 | 124118239 | C | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118248 | C | G | single_nucleotide_variant | Benign | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118250 | T | G | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118254 | G | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118268 | C | T | single_nucleotide_variant | Likely_benign | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118287 | G | C | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118297 | C | A | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter | ||
EIF2B1 | chr12 | 124118312 | C | T | single_nucleotide_variant | Uncertain_significance | Leukoencephalopathy_with_vanishing_white_matter |
nsSNVs with sample frequency (size of circle) from TCGA 33 cancers. |
SNVs and Indels |
Gene | Cancer type | Chromosome | Start | End | RefSeeq | MutSeq | Mutation type | AAchange | # samples |
EIF2B1 | STAD | chr12 | 124106442 | 124106442 | G | A | Missense_Mutation | p.A260V | 4 |
EIF2B1 | BRCA | chr12 | 124114778 | 124114778 | T | C | Missense_Mutation | p.R103G | 4 |
EIF2B1 | ESCA | chr12 | 124111678 | 124111678 | C | T | Missense_Mutation | p.R132K | 3 |
EIF2B1 | ESCA | chr12 | 124116905 | 124116905 | C | G | Missense_Mutation | p.L34F | 3 |
EIF2B1 | BLCA | chr12 | 124109399 | 124109399 | C | A | Nonsense_Mutation | p.E188* | 3 |
EIF2B1 | PRAD | chr12 | 124106408 | 124106408 | C | T | Silent | p.P271P | 3 |
EIF2B1 | STAD | chr12 | 124111624 | 124111624 | A | G | Missense_Mutation | p.V150A | 2 |
EIF2B1 | STAD | chr12 | 124107237 | 124107237 | G | A | Silent | p.F233F | 2 |
EIF2B1 | ESCA | chr12 | 124114969 | 124114969 | A | G | Missense_Mutation | p.I76T | 2 |
EIF2B1 | SKCM | chr12 | 124114956 | 124114956 | G | A | Silent | p.S80S | 2 |
EIF2B1 | BRCA | chr12 | 124110991 | 124110991 | C | G | Missense_Mutation | p.V178L | 2 |
EIF2B1 | ESCA | chr12 | 124111668 | 124111668 | C | T | Silent | 2 | |
EIF2B1 | SKCM | chr12 | 124114824 | 124114824 | G | A | Silent | p.S87S | 2 |
EIF2B1 | ESCA | chr12 | 124111678 | 124111678 | C | T | Missense_Mutation | 2 | |
EIF2B1 | SKCM | chr12 | 124114825 | 124114825 | G | A | Missense_Mutation | p.S87F | 2 |
EIF2B1 | CESC | chr12 | 124111692 | 124111692 | A | T | Silent | 2 | |
EIF2B1 | ESCA | chr12 | 124116905 | 124116905 | C | G | Missense_Mutation | 2 | |
EIF2B1 | SKCM | chr12 | 124114980 | 124114980 | G | A | Silent | p.F72F | 2 |
EIF2B1 | SKCM | chr12 | 124111662 | 124111662 | G | A | Silent | p.V137V | 2 |
EIF2B1 | ESCA | chr12 | 124111668 | 124111668 | C | T | Silent | p.L135L | 2 |
EIF2B1 | STAD | chr12 | 124111688 | 124111688 | C | T | Missense_Mutation | p.A129T | 2 |
EIF2B1 | LGG | chr12 | 124111689 | 124111689 | G | A | Silent | p.H128H | 2 |
EIF2B1 | ESCA | chr12 | 124111668 | 124111668 | C | T | Silent | p.L135 | 1 |
EIF2B1 | PRAD | chr12 | 124106308 | 124106308 | G | T | Missense_Mutation | p.L305M | 1 |
EIF2B1 | GBM | chr12 | 124111633 | 124111633 | C | T | Missense_Mutation | p.R147Q | 1 |
EIF2B1 | LGG | chr12 | 124111476 | 124111476 | T | C | Silent | p.A199A | 1 |
EIF2B1 | READ | chr12 | 124107223 | 124107223 | A | G | Missense_Mutation | p.L238P | 1 |
EIF2B1 | HNSC | chr12 | 124107222 | 124107222 | G | A | Missense_Mutation | 1 | |
EIF2B1 | LGG | chr12 | 124111689 | 124111689 | G | A | Silent | 1 | |
EIF2B1 | SARC | chr12 | 124107224 | 124107224 | G | T | Missense_Mutation | 1 | |
EIF2B1 | HNSC | chr12 | 124111604 | 124111604 | G | T | Missense_Mutation | 1 | |
EIF2B1 | LIHC | chr12 | 124106388 | 124106388 | G | - | Frame_Shift_Del | p.P278fs | 1 |
EIF2B1 | HNSC | chr12 | 124106419 | 124106419 | C | G | Missense_Mutation | 1 | |
EIF2B1 | STAD | chr12 | 124106441 | 124106441 | C | T | Silent | p.A260A | 1 |
EIF2B1 | LUAD | chr12 | 124106443 | 124106443 | C | A | Missense_Mutation | p.A260S | 1 |
EIF2B1 | HNSC | chr12 | 124107222 | 124107222 | G | A | Missense_Mutation | p.S200F | 1 |
EIF2B1 | THCA | chr12 | 124111656 | 124111656 | T | C | Silent | 1 | |
EIF2B1 | LUAD | chr12 | 124116902 | 124116902 | C | G | Missense_Mutation | p.K35N | 1 |
EIF2B1 | HNSC | chr12 | 124106419 | 124106419 | C | G | Missense_Mutation | p.E268Q | 1 |
EIF2B1 | LUSC | chr12 | 124110982 | 124110982 | C | T | Missense_Mutation | p.A181T | 1 |
EIF2B1 | HNSC | chr12 | 124107222 | 124107222 | G | A | Silent | p.L238L | 1 |
EIF2B1 | CESC | chr12 | 124107251 | 124107251 | C | T | Missense_Mutation | 1 | |
EIF2B1 | LUSC | chr12 | 124115076 | 124115076 | C | G | Missense_Mutation | p.E40D | 1 |
EIF2B1 | ESCA | chr12 | 124107310 | 124107310 | T | A | Splice_Site | 1 | |
EIF2B1 | KIRC | chr12 | 124116921 | 124116921 | G | A | Missense_Mutation | p.T29M | 1 |
EIF2B1 | CESC | chr12 | 124111692 | 124111692 | A | T | Silent | p.T127 | 1 |
EIF2B1 | OV | chr12 | 122672352 | 122672352 | G | A | Silent | p.D274 | 1 |
EIF2B1 | SKCM | chr12 | 124114968 | 124114968 | G | A | Silent | p.I76I | 1 |
EIF2B1 | KIRC | chr12 | 124116922 | 124116922 | T | A | Missense_Mutation | p.T29S | 1 |
EIF2B1 | COAD | chr12 | 124114967 | 124114969 | TGA | - | In_Frame_Del | p.76_77del | 1 |
EIF2B1 | PAAD | chr12 | 124115056 | 124115056 | G | A | Missense_Mutation | p.A47V | 1 |
EIF2B1 | ESCA | chr12 | 124107310 | 124107310 | T | A | Splice_Site | . | 1 |
EIF2B1 | SKCM | chr12 | 124116961 | 124116961 | C | T | Missense_Mutation | p.E16K | 1 |
EIF2B1 | KIRC | chr12 | 124111564 | 124111564 | C | G | Missense_Mutation | p.C170S | 1 |
EIF2B1 | ESCA | chr12 | 124107310 | 124107310 | T | A | Splice_Site | e8-2 | 1 |
EIF2B1 | GBM | chr12 | 124116941 | 124116941 | T | C | Silent | p.S22S | 1 |
Copy number variation (CNV) of EIF2B1 * Click on the image to open the original image in a new window. |
Fusion gene breakpoints (product of the structural variants (SVs)) across EIF2B1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion genes with this translation factor from FusionGDB2.0. |
FusionGDB2 ID | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
79341 | BRCA | TCGA-A7-A13D-01A | ABCB9 | chr12 | 123428938 | - | EIF2B1 | chr12 | 124107308 | - |
97239 | STAD | TCGA-BR-4366-01A | EIF2B1 | chr12 | 124116892 | - | ACSS3 | chr12 | 81627128 | + |
87788 | N/A | FN089530 | EIF2B1 | chr12 | 124105981 | - | CPED1 | chr7 | 120869070 | - |
100719 | SARC | TCGA-PC-A5DN-01A | EIF2B1 | chr12 | 124105326 | - | DIABLO | chr12 | 122702805 | - |
97882 | N/A | AA808854 | EIF2B1 | chr12 | 124109928 | - | RAB31 | chr18 | 9720190 | - |
94629 | Non-Cancer | TCGA-55-6971-11A | EIF2B1 | chr12 | 124105936 | - | SFTPC | chr8 | 22021031 | + |
79341 | OV | TCGA-29-1702 | GTF2H3 | chr12 | 124118419 | + | EIF2B1 | chr12 | 124115080 | - |
79341 | SARC | TCGA-DX-A48K-01A | GTF2H3 | chr12 | 124130108 | + | EIF2B1 | chr12 | 124109409 | - |
79345 | BRCA | TCGA-AR-A1AI-01A | SBNO1 | chr12 | 123849248 | - | EIF2B1 | chr12 | 124116993 | - |
Top |
|
Kaplan-Meier plots with logrank tests of overall survival (OS) |
Cancer type | Translation factor | Coefficent | Hazard ratio | Wald test pval | Likelihool ratio pval | Logrank test pval | # samples |
Top |
|
Differential gene expression between female and male. (Wilcoxon test, pval<0.05) |
Cancer type | Translation factor | pval | adj.p |
LIHC | EIF2B1 | 0.00276605119666496 | 0.077 |
SARC | EIF2B1 | 0.0358280143152734 | 0.97 |
Top |
|
Differential gene expression between young and old age groups (Wilcoxon test, pval<0.05) |
Cancer type | Translation factor | pval | adj.p |
THCA | EIF2B1 | 0.0381410813433593 | 1 |
LGG | EIF2B1 | 0.000524110461421468 | 0.017 |
OV | EIF2B1 | 0.00317691574686768 | 0.098 |
UCEC | EIF2B1 | 0.04785472700105 | 1 |
ESCA | EIF2B1 | 0.00204777897545032 | 0.066 |
Top |
|
Drugs targeting genes involved in this translation factor. (DrugBank Version 5.1.8 2021-05-08) |
UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
|
Diseases associated with this translation factor. (DisGeNet 4.0) |
Disease ID | Disease Name | # PubMeds | Disease source |
C1858991 | Childhood Ataxia with Central Nervous System Hypomyelinization | 6 | GENOMICS_ENGLAND;ORPHANET;UNIPROT |
C0152013 | Adenocarcinoma of lung (disorder) | 1 | CTD_human |
C1847967 | OVARIOLEUKODYSTROPHY | 1 | CTD_human;ORPHANET |